KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326594
Entry
4326594           CDS       T01015                                 
Name
(RefSeq) glucose-1-phosphate adenylyltransferase large subunit 1, chloroplastic/amyloplastic
  KO
K00975  glucose-1-phosphate adenylyltransferase [EC:2.7.7.27]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01250  Biosynthesis of nucleotide sugars
Module
osa_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4326594
   00520 Amino sugar and nucleotide sugar metabolism
    4326594
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.27  glucose-1-phosphate adenylyltransferase
     4326594
SSDB
Motif
Pfam: NTP_transferase Hexapep NHR2
Other DBs
NCBI-GeneID: 4326594
NCBI-ProteinID: XP_015650361
UniProt: Q7G065
LinkDB
Position
1:25354534..25361907
AA seq 518 aa
MQFMMPLDTNACAQPMRRAGEGAGTERLMERLNIGGMTQEKALRKRCFGDGVTGTARCVF
TSDADRDTPHLRTQSSRKNYADASHVSAVILGGGTGVQLFPLTSTRATPAVPVGGCYRLI
DIPMSNCFNSGINKIFVMTQFNSASLNRHIHHTYLGGGINFTDGSVQVLAATQMPDEPAG
WFQGTADAIRKFMWILEDHYNQNNIEHVVILCGDQLYRMNYMELVQKHVDDNADITISCA
PIDGSRASDYGLVKFDDSGRVIQFLEKPEGADLESMKVDTSFLSYAIDDKQKYPYIASMG
IYVLKKDVLLDILKSKYAHLQDFGSEILPRAVLEHNVKACVFTEYWEDIGTIKSFFDANL
ALTEQPPKFEFYDPKTPFFTSPRYLPPARLEKCKIKDAIISDGCSFSECTIEHSVIGISS
RVSIGCELKDTMMMGADQYETEEETSKLLFEGKVPIGIGENTKIRNCIIDMNARIGRNVI
IANTQGVQESDHPEEGYYIRSGIVVILKNATIKDGTVI
NT seq 1557 nt   +upstreamnt  +downstreamnt
atgcaattcatgatgccattggatacgaatgcttgtgcacaaccaatgagaagggctggt
gagggtgctgggactgagaggttgatggaaagattgaatattgggggcatgactcaggag
aaagcactgaggaagaggtgctttggtgatggagttactggaactgcacgatgtgtgttc
acatcagatgctgatagagacactcctcatcttcggacacaatcctcccgaaagaattat
gctgatgcaagccacgtttctgctgtcattttgggtggaggcactggagttcaactcttt
cctctgacaagcacaagggctacccccgctgttcctgttggaggatgttacaggcttatt
gacatccctatgagcaattgcttcaatagcggaataaataaaatatttgtgatgactcag
ttcaattctgcttctcttaatcgccatatccatcatacataccttggtggggggatcaac
tttactgatgggtctgtgcaggtattggctgctacacaaatgcctgacgaaccggctgga
tggttccagggtacagcagatgctatcagaaaatttatgtggatacttgaggatcattac
aatcaaaacaacattgagcacgttgtaatcttgtgtggagatcagctttacaggatgaat
tacatggagcttgtgcagaaacatgtcgatgacaatgctgacattaccatatcatgtgct
cccatcgacgggagccgagcttctgactatggactggtgaagtttgatgattcaggccgt
gtgatccaatttcttgagaaaccagagggtgctgatttggaatcgatgaaagttgatacc
agcttcctcagctatgcaatagatgacaaacaaaagtatccctacattgcatcaatggga
atttatgtcttgaaaaaggatgttcttttagacattctgaagtcaaaatatgcacacctg
caagactttggatcagaaattctcccgagagctgttttagagcataatgtgaaggcatgt
gtcttcacagaatattgggaggatattggaacaatcaaatcattttttgatgctaacttg
gccctcaccgagcagcctccaaagttcgaattttatgatccaaaaactcctttcttcacc
tcacctcgatacttacctccagcaagattggagaagtgcaagatcaaagatgcaataatc
tccgatggctgttcctttagtgaatgcaccattgagcattctgtcattggaatctcttca
cgcgttagcatcgggtgtgaactcaaggataccatgatgatgggtgcagatcaatatgaa
actgaagaagaaacttcaaagctattgtttgaaggcaaggtcccaattggtataggcgag
aacacaaagataaggaactgtatcatcgacatgaatgctagaattggcaggaacgtgatc
attgcaaacactcagggggtccaagagtctgatcaccctgaagagggatactacataagg
tctggaattgtggtgatcctgaagaatgcaaccatcaaggacgggaccgtcatataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334020
Entry
4334020           CDS       T01015                                 
Name
(RefSeq) glucose-1-phosphate adenylyltransferase large subunit
  KO
K00975  glucose-1-phosphate adenylyltransferase [EC:2.7.7.27]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01250  Biosynthesis of nucleotide sugars
Module
osa_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4334020
   00520 Amino sugar and nucleotide sugar metabolism
    4334020
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.27  glucose-1-phosphate adenylyltransferase
     4334020
SSDB
Motif
Pfam: NTP_transferase NTP_transf_3 Hexapep
Other DBs
NCBI-GeneID: 4334020
NCBI-ProteinID: XP_015632018
UniProt: Q6AVT2
LinkDB
Position
3:complement(30099383..30104621)
AA seq 511 aa
MAAMDLRVAAPASVAAAARCGTSLARPWPARAVGGGGGGGGRGRRLSVRTSVATTEAAAA
AVGASEDAALEARDSKTVVAVILGGGAGTRLFPLTKRRAKPAVPIGGAYRLIDVPMSNCI
NSGINKVYILTQFNSASLNRHLSRAYNFSNGVAFGDGFVEVLAATQTPGSEGKRWFQGTA
DAVRQFDWLFDDAKAKDIDDVLILSGDHLYRMDYMDFVQSHRQRGADISICCLPIDDSRA
SDFGLMKIDDTGRVIAFSEKPKGDDLKAMQVDTTVLGLPQDEAKEKPYIASMGVYIFKKE
ILLNLLRWRFPTANDFGSEIIPASAKEINVKAYLFNDYWEDIGTIKSFFEANLSLAEQPP
RFSFYDANKPMYTSRRNLPPSMINNSKITDSIISHGCFLDSCRIEHSVVGIRSRIGSNVH
LKDTVMLGADFYETDLERGELLAEGKVPIGIGENTKIQNCIIDKNARIGKNVTISNSEGV
QEADRTSEGFYIRSGITIVLKNSIIADGLVI
NT seq 1536 nt   +upstreamnt  +downstreamnt
atggcggcgatggacctgcgggtggccgccccggcctccgtggccgcggcggcgcggtgc
ggcacgagcctggcgaggccgtggcctgcccgggcggtgggaggaggaggaggaggagga
ggacggggccggcgtctctccgtgcggacgtccgtcgcgaccaccgaggccgccgccgcc
gccgtgggcgcctcggaggacgcggcgctggaggcgcgggactcgaagacggtggtggcg
gtcatcctcggcggcggcgcggggacgaggctgttcccgctcaccaagcgcagggccaag
cccgcggtgcccattggcggagcgtacaggctgatcgacgtgccgatgagcaactgcata
aacagcggcatcaacaaggtgtacattctcacccagttcaactccgcgtcgctcaaccgg
cacctttcccgggcgtataacttcagcaacggcgtcgcgtttggagatggattcgtcgag
gtcctagcagcaactcagacgcctggatcggagggaaagaggtggtttcagggtacagct
gatgctgttcggcaatttgactggctttttgatgatgccaaagctaaagacatcgatgat
gtgctgattctttctggtgatcatctctaccgcatggactacatggactttgttcagagt
catcggcaaagaggtgcagacatcagcatctgttgcttgcctattgatgatagccgggca
tctgattttggtctaatgaagatagacgacacaggaagagttatcgcatttagtgaaaaa
ccaaaaggagatgatttaaaggcaatgcaagttgacaccactgttctaggcttaccacag
gatgaagcaaaagagaagccatacatagcgtcaatgggggtttatatatttaagaaagag
atacttctaaatcttttgagatggcgttttcccacagcaaatgactttggatctgaaatc
attcctgcttcagcaaaagaaatcaatgtaaaggcatatcttttcaatgattactgggaa
gacataggaactataaaatcattctttgaagccaatctttctcttgctgaacagccaccg
agattcagcttttatgatgctaataaaccaatgtacacatcacggagaaacttaccgcca
tctatgatcaataatagtaagatcactgattcaatcatttcccatggatgtttcttggat
agctgcaggatagagcacagtgttgttggaatccgttctaggataggttccaatgtgcac
ctcaaggatacagtaatgcttggtgctgatttctatgagactgatctggaaagaggagaa
ctgctggctgaaggaaaggttcctattggaatcggggagaatacaaagattcagaactgc
ataatagacaagaatgcgaggatagggaagaatgtaacaatttccaactctgagggtgta
caggaagcagataggacctctgaaggcttctacatccgatcaggcatcaccatcgtatta
aagaactcgataattgcagatggattagtcatctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339718
Entry
4339718           CDS       T01015                                 
Name
(RefSeq) glucose-1-phosphate adenylyltransferase large subunit, chloroplastic/amyloplastic
  KO
K00975  glucose-1-phosphate adenylyltransferase [EC:2.7.7.27]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01250  Biosynthesis of nucleotide sugars
Module
osa_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4339718
   00520 Amino sugar and nucleotide sugar metabolism
    4339718
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.27  glucose-1-phosphate adenylyltransferase
     4339718
SSDB
Motif
Pfam: NTP_transferase NHR2
Other DBs
NCBI-GeneID: 4339718
NCBI-ProteinID: XP_015640472
UniProt: Q688T8
LinkDB
Position
5:complement(28871811..28877272)
AA seq 519 aa
MQFSSVFPLEGKACVSPIRRGGEGSASDRLKIGDSSSIKHDRAVRRMCLGYRGTKNGAQC
VLTSDAGPDTLHVRTSFRRNFADPNEVAAVILGGGTGTQLFPLTSTRATPAVPIGGCYRL
IDIPMSNCFNSGINKIFIMTQFNSASLNRHIHRTYLGGGINFTDGSVEVLAATQMPGEAA
GWFQGTADAVRKFIWVLEDYYKHKAIEHILILSGDQLYRMDYMELVQKHVDDNADITLSC
APVGESRASDYGLVKFDSSGRVIQFSEKPKGTDLEAMKVDTSFLNFAIDDPTKFPYIASM
GVYVFKRDVLLNLLKSRYAELHDFGSEILPRALHEHNVQAYVFADYWEDIGTIRSFFDAN
MALCEQPPKFEFYDPKTPFFTSPRYLPPTKSDKCRIKDAIISHGCFLRECTIEHSIVGVR
SRLNSACELKNTMMMGADLYETEDEISRLLSEGKVPIGVGENTKINNCIIDMNARVGRNV
VITNSEGVQESDRPEEGYYIRSGIVVILKNATIKDGKVI
NT seq 1560 nt   +upstreamnt  +downstreamnt
atgcagttcagcagtgtgtttcccttagagggtaaagcatgcgtgagcccaataaggaga
ggtggtgagggctcagctagtgatagattgaagatcggggacagtagcagcatcaagcat
gatagagcagtgaggaggatgtgtcttggttataggggcaccaaaaacggtgcacaatgt
gtgctcacctcagatgctggcccagacactcttcatgtccgaacatcattccggaggaac
tttgcggatccaaatgaggttgctgctgttatattgggtggtggcaccgggactcaactt
tttcctctcacaagcacaagggccacgcctgctgttcctattggaggatgctataggctt
atcgatatccccatgagcaactgtttcaacagtggcataaacaagatattcataatgact
caattcaactcagcatctcttaatcgtcacattcatcgtacgtaccttggtggtggaatc
aactttactgatggatctgttgaggtattagccgctacacaaatgcctggggaggctgct
ggttggttccagggtacagcagatgcagttagaaaatttatctgggttcttgaggactat
tacaagcataaagctatagaacacattttaatcttgtcaggagatcagctttatcgtatg
gactacatggagcttgtgcagaaacatgttgatgacaatgctgacattactttatcatgt
gctcctgttggagagagtcgagcatctgactatggactagtgaagttcgacagttcaggc
cgtgtaattcaattttctgaaaaacccaagggcactgacttggaagcaatgaaagtggat
accagctttctcaattttgccatagacgacccgactaaatttccctacattgcttcgatg
ggagtttatgtcttcaaaagagatgttcttttaaaccttctaaagtcaagatatgcagaa
ctacatgactttgggtctgaaatcctcccaagagctttacatgagcacaatgtacaggca
tatgtcttcgctgactactgggaagacattggaacgatcagatcgttctttgatgcaaac
atggccctttgcgagcagcctcccaagtttgagttttatgatccaaaaactcccttcttc
acttcacctcgatatttgccgccaacaaagtcagataaatgcaggattaaagatgcgata
atttcccatggctgtttcttgcgtgaatgtaccatcgagcattcgatagttggagtccgc
tcacgccttaactctgcatgtgagctcaagaataccatgatgatgggtgcggatttgtac
gaaactgaagatgaaatttcaagactactgtcagaaggcaaggtccccattggtgtaggg
gaaaacacaaagataaacaactgcatcatcgacatgaacgcgagggttggaaggaacgtg
gtcatcacaaacagcgagggtgtccaagaaagtgatcggcctgaggaagggtactacata
aggtcgggaatcgtggtgatcctgaagaacgcgaccatcaaggacgggaaggtcatatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339996
Entry
4339996           CDS       T01015                                 
Name
(RefSeq) nudix hydrolase 14, chloroplastic
  KO
K18447  ADP-sugar diphosphatase [EC:3.6.1.21]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00051  Fructose and mannose metabolism
osa00230  Purine metabolism
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    4339996
   00500 Starch and sucrose metabolism
    4339996
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4339996
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.21  ADP-sugar diphosphatase
     4339996
SSDB
Motif
Pfam: NUDIX
Other DBs
NCBI-GeneID: 4339996
NCBI-ProteinID: XP_015641722
UniProt: Q9SNS9 A0A0P0WSD5
LinkDB
Position
6:complement(1574538..1577199)
AA seq 325 aa
MAAAAARQCLLGFRRAAPPPLPLLSTRAPSPAPSSRRGARMASSGDHAPQLSTAVAVPGA
GAPVRVVAAPGLTEADFTSAVESSLFRQWLKNLQEEKGVLTYGRLNLRQILIQGVDMFGK
RVGFVKFKADIIDEETKAKIPGIVFARGPAVAVLILLESKGQTYAVLTEQVRVPVGKFIL
ELPAGMLDDEKGDFVGTAVREVEEETGIKLNLEDMIDLTALLNPDTGCRMLPSPGGCDEE
IGLFLYRGHADEDTLRALQGKETGLRDHGELIKLRVVPYSQLWRATADAKALSAIALYEM
AKREGLLPSSPTTSRRRGSSSSANL
NT seq 978 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcgcgtcagtgtctgcttggattccgacgagcagcgccgccgcct
ctcccgctcctgagcacgcgcgctccctctcccgctccgtccagccgccgcggcgcgcgc
atggcctcgtccggcgaccacgcgccgcagctcagcaccgccgtcgcggtgcccggcgcg
ggcgcgcccgtccgcgtcgtggccgcgccgggcctcaccgaggcggatttcacgagcgcg
gtggaatcctcgctgttcaggcagtggctgaagaacctgcaggaggagaagggggtcctc
acctacgggaggctgaacctgaggcaaatcctcatccagggggttgacatgtttgggaaa
cgcgtggggtttgtcaagttcaaggctgacatcatcgacgaggagaccaaagccaagatt
ccaggaattgtatttgcaagagggcctgctgttgctgtgttgattcttttggagtctaaa
gggcaaacttacgctgttcttacagaacaggttagagttcctgttggaaaatttatattg
gaactacctgctgggatgctagacgatgaaaagggagattttgttggcactgcagtccgt
gaggttgaagaagaaactggaattaagctaaatttagaggatatgattgaccttactgca
ttgctgaaccctgacactggatgcagaatgcttccttcaccgggtggctgcgacgaagag
attgggctgttcctgtacagaggccacgccgacgaggacacccttagggctctccaaggg
aaggagactgggctgcgcgaccatggcgagctgatcaagctgcgggtggtgccgtacagc
cagctgtggcgcgccaccgccgacgccaaggcgctcagcgccatcgccctgtacgagatg
gccaagagggaaggcctcctgccgtcgtctccgacgacctctcgccgccgtggcagctcg
tcgtcggccaacttgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342819
Entry
4342819           CDS       T01015                                 
Name
(RefSeq) glucose-1-phosphate adenylyltransferase large subunit 1
  KO
K00975  glucose-1-phosphate adenylyltransferase [EC:2.7.7.27]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01250  Biosynthesis of nucleotide sugars
Module
osa_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4342819
   00520 Amino sugar and nucleotide sugar metabolism
    4342819
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.27  glucose-1-phosphate adenylyltransferase
     4342819
SSDB
Motif
Pfam: NTP_transferase Fucokinase
Other DBs
NCBI-GeneID: 4342819
NCBI-ProteinID: XP_015645226
UniProt: Q0D7I3
LinkDB
Position
7:complement(7983125..7989305)
AA seq 509 aa
MATCSWAATTAAAAPPRPPARCRSRVAALRRTAAASAAAASCVLAEAPKGLKVEQADAVE
PAAAAAARRDVGPDTVASIILGGGAGTRLFPLTRTRAKPAVPVGGCYRLIDIPMSNCINS
KINKIYVLTQFNSQSLNRHIARTYNIGEGVGFGDGFVEVLAATQTTGESGKRWFQGTADA
VRQFLWLFEDARLKRIENILILSGDHLYRMDYMDFVQKHVDKGADISVACVPVDESRASD
FGLMKTDKNGRITDFLEKPKDESLKSMQLDMGTFGLRPEVADTCKYMASMGIYVFRTDIL
LRLLRGHYPTANDFGSEVIPMAAKDYNVQAYLFDGYWEDIGTIKSFFEANLALTDQSPNF
YFYDPVKPIFTSPRFLPPTKVENCKVLNSIVSHGCFLTECSVDRSVIGVRSRLEPGVQLK
DTMMMGADYYQTEAERFSELSDGKVPVGVGENTIIRNCIIDKNARIGKNVMIMNSQNVQE
AERPLEGFYIRSGITVVLKNAVIPDGTVI
NT seq 1530 nt   +upstreamnt  +downstreamnt
atggcgacctgctcgtgggccgccaccacggcggcggcggcgcccccccgcccgcccgcc
aggtgccgctcgcgcgtcgccgcgctccgccgcacggccgccgcctccgccgccgccgcc
agctgcgtcctcgccgaagcgcccaaggggctcaaggtggagcaggcggatgcggtcgag
ccagcggcggcggcggcggcgcggagggacgtggggccggacacggtggcgtccatcatc
ctcggcggcggcgccggcacgcgcctcttccctctcacgcggaccagggccaagcccgcg
gtgcctgttgggggatgttacaggctgatcgatatcccgatgagcaactgcataaacagc
aagatcaacaagatctacgttctcacccagttcaactcccagtctctcaaccgtcacatc
gcgcgcacttataacattggcgagggggttggatttggtgatggctttgtggaggtgctg
gcagctacccagacaacaggggaatcaggaaagcgatggttccagggaacagccgatgct
gtcaggcagttcctgtggctatttgaggatgcaaggctcaaacgcatagagaacatacta
attctatctggtgatcatctgtataggatggattatatggactttgtccagaagcatgtt
gacaaaggtgctgatatttcagtcgcttgtgttcctgtggatgagagtcgagcttctgat
tttggattgatgaagactgacaagaatggacgcattactgattttctcgaaaagcccaag
gatgaaagcttgaaatcaatgcaactagatatgggaacttttggtttgcgcccagaagtt
gcagatacatgcaaatacatggcttcaatgggaatatatgtattcaggactgatatcttg
ttaagacttctaagaggacattatcctacagcgaatgattttgggtcagaagttatccca
atggctgcaaaagactacaatgtgcaggcctatctatttgatggttactgggaagatatt
gggacaataaagtcattctttgaggcaaatcttgctctcacagatcagtcgccaaacttc
tatttttatgatcctgtgaagcccatattcacatctcctagatttttacctccaacgaaa
gtagaaaactgcaaggttctgaactctatagtttcccatgggtgctttctaacagaatgt
agtgttgatcgctctgttattggtgtccgttcaagattagaaccgggggtgcagctgaag
gacaccatgatgatgggggcagattactatcagactgaagctgagagattttctgaattg
tctgatggaaaagtaccagttggcgttggagaaaacaccataataaggaactgtatcatc
gacaagaatgctcgaattggaaagaatgtaatgattatgaactcacagaatgtgcaagaa
gcagagagaccattagagggtttctacattcgttctgggataacggtagtgcttaaaaat
gcggtgattccagatggtacagttatctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345339
Entry
4345339           CDS       T01015                                 
Name
(RefSeq) glucose-1-phosphate adenylyltransferase small subunit, chloroplastic/amyloplastic isoform X1
  KO
K00975  glucose-1-phosphate adenylyltransferase [EC:2.7.7.27]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01250  Biosynthesis of nucleotide sugars
Module
osa_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4345339
   00520 Amino sugar and nucleotide sugar metabolism
    4345339
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.27  glucose-1-phosphate adenylyltransferase
     4345339
SSDB
Motif
Pfam: NTP_transferase NTP_transf_3 Hexapep
Other DBs
NCBI-GeneID: 4345339
NCBI-ProteinID: XP_015650970
UniProt: P15280
LinkDB
Position
8:complement(15666334..15672600)
AA seq 514 aa
MAMAAAMGVASPYHAAHAAASTSCDSLRLLVAEGRPRRPRGVASSSSSSSSAGRRRRPLV
FSPRAVSDSKSSQTCLDPDASTSVLGIILGGGAGTRLYPLTKKRAKPAVPLGANYRLIDI
PVSNCLNSNISKIYVLTQFNSASLNRHLSRAYGNNIGGYKNEGFVEVLAAQQSPDNPNWF
QGTADAVRQYLWLFEEHNVMEFLILAGDHLYRMDYEKFIQAHRETDSDITVAALPMDEKR
ATAFGLMKIDEEGRIVEFAEKPKGEQLKAMMVDTTILGLDDVRAKEMPYIASMGIYVISK
NVMLQLLREQFPGANDFGSEVIPGATNIGMRVQAYLYDGYWEDIGTIEAFYNANLGITKK
PVPDFSFYDRSAPIYTQPRHLPPSKVLDADVTDSVIGEGCVIKNCKIHHSVVGLRSCISE
GAIIEDSLLMGADYYETEADKKLLGEKGGIPIGIGKNCHIRRAIIDKNARIGDNVKIINV
DNVQEAARETDGYFIKSGIVTVIKDALLPSGTVI
NT seq 1545 nt   +upstreamnt  +downstreamnt
atggcgatggcggcagccatgggcgtggcctccccctaccacgccgcccacgccgccgca
tccacatcgtgcgactcgctccgcctcctcgtcgcggaaggccggccgcggcggccgcga
ggggtggcctcctcctcctcctcctcctcttcggcggggaggcggaggcggccgctcgtc
ttctccccgcgcgcggtgtccgactccaagagctcgcagacctgcctcgacccggacgcc
agcacgagtgtgcttggaatcattcttggaggtggtgcagggactagattgtatcccctc
accaagaagcgtgccaagcctgccgtgcctctgggtgccaactacaggcttattgatatc
cctgtcagcaactgtttgaacagcaacatatccaagatctatgtgctgacacaattcaac
tctgcctctctgaaccgtcacctgtcaagagcctatgggaacaacattggcgggtacaag
aatgaagggttcgttgaagtcctcgctgcacagcagagcccagataatcctaactggttt
cagggtactgcagatgctgtaagacagtacttatggctatttgaggagcataatgttatg
gagtttctaattctggctggagatcacctttaccgcatggactatgaaaagttcattcag
gcacacagagaaacagattctgatattactgttgctgccctgccaatggatgagaaacgt
gcaactgcattcggcctcatgaaaattgacgaggaagggagaatagttgaatttgcagag
aaaccaaaaggagaacaattgaaagcaatgatggttgacactaccatacttggccttgac
gacgtgagggcaaaagaaatgccttatattgctagcatgggtatctatgtgattagtaaa
aatgtaatgcttcagctcctccgtgaacaatttcctggagctaatgactttggaagtgaa
gtcattccaggtgcaacaaacatcggaatgagggtacaagcttacttgtatgatggttac
tgggaagacattggtaccattgaggcattctataatgcaaatctgggaataacgaaaaag
cctgtaccagatttcagtttctatgaccggtctgctccaatttatacacaacctcgacac
ttgcctccttcgaaggttcttgatgctgatgtgacagacagtgtcattggtgaaggttgt
gttattaaaaactgtaagatacaccattcagtagttggactccggtcctgcatttctgaa
ggcgcaataatagaggactcattactcatgggagctgactactacgagactgaagcagac
aagaaactccttggtgaaaaaggtggcattcccattggtattgggaagaattgccacatt
agaagggcaatcatcgacaagaatgctcgtattggagataatgtgaagataatcaatgtt
gacaatgtccaagaagctgcaagagagactgatggatactttatcaaaagtggcattgtt
accgtgatcaaggatgctttgctccctagcggaacagttatatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346656
Entry
4346656           CDS       T01015                                 
Name
(RefSeq) glucose-1-phosphate adenylyltransferase small subunit, chloroplastic/amyloplastic-like
  KO
K00975  glucose-1-phosphate adenylyltransferase [EC:2.7.7.27]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01250  Biosynthesis of nucleotide sugars
Module
osa_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4346656
   00520 Amino sugar and nucleotide sugar metabolism
    4346656
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.27  glucose-1-phosphate adenylyltransferase
     4346656
SSDB
Motif
Pfam: NTP_transferase NTP_transf_3 Hexapep Fucokinase
Other DBs
NCBI-GeneID: 4346656
NCBI-ProteinID: XP_015612224
UniProt: Q69T99
LinkDB
Position
9:complement(7245375..7249819)
AA seq 500 aa
MAMMAMGAASWAPIPAPARAAAAFYPGRDLAAARRRRGAAARRPFVFTPRAVSDSRSSQT
CLDPDASTSVLGIILGGGAGTRLYPLTKKRAKPAVPLGANYRLIDIPVSNCLNSNVSKIY
VLTQFNSASLNRHLSRAYGNNIGGYKNEGFVEVLAAQQSPENPNWFQGTADAVRQYLWLF
EEHNVMEFLILAGDHLYRMDYQKFIQAHRETNADITVAALPMDEERATAFGLMKIDDEGR
IIEFAEKPKGEKLKSMMVDTTILGLDTERAKELPYIASMGIYVFSKDVMLKLLRQNFPAA
NDFGSEVIPGATEIGMRVQAYLYDGYWEDIGTIEAFYNANLGITKKPVPDFSFYDRSAAI
YTQPRYLPPSKVLDADVTDSVIGEGCVIRHCTINHSVVGLRSCISEGAVIEDSLLMGADY
YETETDKKALSETGGIPIGIGKNAHIRKAIIDKNARIGENVKIINVDNIQEASRETDGYF
IKSGIVTVIKDALIPSGTVI
NT seq 1503 nt   +upstreamnt  +downstreamnt
atggcgatgatggcgatgggcgcggcgtcctgggccccgatcccggcgccggcgagggcg
gcggccgcattctatcccggccgcgatcttgcggcggcgaggcggcggcgtggggcggcg
gcgaggaggccgttcgtgttcacgccgcgtgccgtgtcggactcccggagctcgcagacg
tgcctcgatccggacgccagcacgagtgttcttgggatcatccttggaggtggtgctggg
acaaggctgtatccgctgacaaagaagagggcgaagccggcggtgccgttgggtgctaat
tacaggctcatagatatcccggtcagcaactgtctgaacagcaatgtgtcgaagatctat
gtcctgacacagttcaactccgcgtcgctcaatcgtcacctctcgagggcctatggaaac
aacattggtggttacaagaacgaggggtttgttgaagttcttgctgcgcagcagagccca
gagaatcctaactggtttcagggtactgcagatgctgtgcgacaatacttatggctattt
gaggaacacaatgttatggagtttctcattttggctggagatcacctgtaccgtatggac
taccaaaagttcattcaggcccacagagaaacaaatgctgatataaccgttgctgcgctg
cccatggatgaagaacgtgctacagcatttggccttatgaagattgatgatgaagggagg
atcattgaatttgcagaaaagccaaaaggagagaagttgaaatcaatgatggttgacact
accatacttggccttgatactgagagggcaaaggaattgccttacattgctagtatggga
atctatgtttttagcaaagatgtgatgcttaagcttctccgtcaaaatttccctgctgca
aatgactttggaagcgaggttattcctggagcaacagaaattggaatgagggtgcaagct
tacttatatgatggttactgggaagatattggtactatagaggcattctacaatgccaac
ttggggataaccaagaaacctgtgccagattttagcttctatgaccgttctgccgcaatt
tatacgcaacctcgatacttgcctccatcaaaagttcttgatgctgatgtgacagacagt
gttattggtgaaggttgtgttattagacattgcacaatcaaccattctgtggttggactc
cggtcctgtatatctgaaggcgcagtgatagaggactctctgctaatgggtgcagactat
tatgagacggagacggacaagaaagccctttctgagactggtggcattcccattggtatt
ggaaagaatgcacacatcagaaaagcaataattgacaagaatgctcgtattggagaaaat
gttaagataatcaatgtcgacaatatccaagaagcttcaagggagactgatggatacttc
atcaaaagtggcattgtcactgtgatcaaggacgccttaatccctagcggaacagtcata
taa

DBGET integrated database retrieval system