KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326683
Entry
4326683           CDS       T01015                                 
Name
(RefSeq) WRKY transcription factor 22
  KO
K13425  WRKY transcription factor 22
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04016  MAPK signaling pathway - plant
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    4326683
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4326683
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:osa03000]
    4326683
Transcription factors [BR:osa03000]
 Eukaryotic type
  Other transcription factors
   WRKY
    4326683
SSDB
Motif
Pfam: WRKY
Other DBs
NCBI-GeneID: 4326683
NCBI-ProteinID: XP_015640600
UniProt: Q5ZEB2 A0A0P0V5F9
LinkDB
Position
1:complement(24945319..24947312)
AA seq 348 aa
MRGPLLLRAVVVVAMEHFNDWDLQAVVRSCSFPQSEPPRVGVGVPAAPGAGGAPVVVAPP
ARAPDGPDQMARASASALYDLEYLDLDHKPFLLPGSSSSSSSSRAVARARGEDDGKGRHE
VMISFPAAAAASTSGAQPRSPSGRKPGIRTPRPKRSKKSQLKKVVYEVPVADGGVSSDLW
AWRKYGQKPIKGSPYPRGYYKCSSMKGCMARKMVERSPAKPGMLVVTYMAEHCHPVPTQL
NALAGTTRHKSAPTGDDDKPTSPGPAAGRAAAGEGVVKCEDVDGNELSAMAADGGAEDTA
AAADDDGELWPEGMGLELDEFLGPMDDDVFEFDHVLEDDGVLGRRLSL
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgcgcggcccgctgctgctgcgcgccgtcgtcgtcgtcgccatggagcacttcaacgac
tgggacctgcaggccgtcgtgcggagctgcagcttcccgcaatcggagcctcctcgcgtc
ggcgtcggcgtccccgcggcgccgggagcgggcggggctccggtggtggtggcgccgccc
gcgcgcgcaccggatggtccggatcagatggcgcgggcgtcggcgtcggcgctgtacgac
ctcgagtacctggatttggatcataagccgttcttgctgcccgggtcgtcgtcttcgtcg
tcgtcgtcccgagcggtggcgcgggcgcgaggggaggatgacggcaaaggcagacacgag
gtgatgatctctttccccgcggcggcggcggcctccacgtccggtgcgcagccgcggtcg
ccgtccggtcggaagccgggcatacgcaccccgcggcctaagagaagcaagaagagccag
ctgaagaaggtggtgtacgaggtgccggtggcggacggcggcgtctcctccgacctgtgg
gcgtggcgcaagtacggccaaaagcccatcaagggctcgccttatccacggggatactac
aagtgcagcagcatgaaggggtgcatggccaggaagatggtggagcgcagcccggccaag
cccgggatgctcgtcgtcacctacatggccgagcactgccaccccgtgccgacccagctc
aacgcgctcgccggcaccacccgccacaagtccgcccctaccggcgacgacgacaagccg
acgtcgccgggccctgcagccggcagagcggccgccggcgagggagtggtcaagtgcgag
gacgtcgacggcaacgagctgtcggcgatggccgcggatggcggcgcagaggacacggcg
gcggcggcggatgacgacggtgagttgtggccggaggggatggggctggagctggacgag
ttcttgggtcccatggatgacgacgtgttcgagttcgaccatgtcttggaggacgacggc
gtgctggggcgacggctctcgctatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9267508
Entry
9267508           CDS       T01015                                 
Name
(RefSeq) WRKY transcription factor 22
  KO
K13425  WRKY transcription factor 22
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04016  MAPK signaling pathway - plant
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    9267508
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    9267508
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:osa03000]
    9267508
Transcription factors [BR:osa03000]
 Eukaryotic type
  Other transcription factors
   WRKY
    9267508
SSDB
Motif
Pfam: WRKY
Other DBs
NCBI-GeneID: 9267508
NCBI-ProteinID: XP_015638808
UniProt: Q75HY9
LinkDB
Position
5:29064576..29066159
AA seq 329 aa
MTITHASSLSRFHPLLKKLIMEYSNDWDLQALVRSCGTAVADSEPEPPAAPSTTRRAEAE
TVFVGRAGGVPEFVGQPVRSSAASFYDLEYLDLYHERPRAPFLVTAPSTSRERGEGGEHE
VLISFPAIASTSGQGRKQPGRKPGVRTARPKRSKKSQLKKVVCEVPVADGGVSTDLWAWR
KYGQKPIKGSPYPRGYYKCSSLKACMARKMVERSPEKPGVLVITYIAEHCHAVPTQLNSL
AGTTRNNKPASPDQQQQQQPSPGGASTDEAAAAAAKTEDSADTTCSMADDENDLWAPVEM
DMNDFFGPFDDDLDHFLDDDAVLGRRLSL
NT seq 990 nt   +upstreamnt  +downstreamnt
atgaccatcacacacgctagctctctttctcgctttcacccgctcctcaagaagctgatc
atggagtactccaacgattgggatctccaggcactggtcaggagctgtggcacggccgtc
gccgactcggagccggagccgccggcggcgccgtcgacgacgcggcgggctgaagccgaa
accgtcttcgttggccgtgctggtggggtgccggagttcgttgggcaaccggtgaggtcg
tcggcggcatcgttttacgacttggagtacttggacctgtaccacgagcggcctcgggcg
ccgttcttggtgacggcgccgtcgacgagccgcgagcgtggggagggcggcgagcatgag
gtgctcatctccttcccggcgattgcctcgacgtccgggcagggtaggaagcagcctggc
cggaaaccgggcgttcgtactgccaggcccaaaagaagcaagaagagccagctgaagaaa
gtggtgtgcgaggtgccggttgccgacggcggcgtctccaccgacctttgggcatggcgc
aagtatggccagaaacctatcaagggctcgccgtatcctcggggatactacaagtgcagt
agcctcaaggcgtgcatggcgaggaagatggtggagcggtcgccggagaagcccggggtg
ctggtcatcacctacatcgccgagcactgccacgccgtgcccacgcagctcaactcgctg
gccggcaccacgcgcaacaacaagccggcgtcccctgaccagcagcagcagcagcagccg
tctcccggcggcgcgtcgacggacgaggcggcggcggcggcggccaagacggaggacagc
gccgacactacgtgctccatggcggacgacgagaacgacctctgggcgccggtggagatg
gatatgaacgatttctttggccccttcgacgatgatctcgaccactttttggatgacgac
gccgttcttggacgccggctgtcgctctag

DBGET integrated database retrieval system