KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326722
Entry
4326722           CDS       T01015                                 
Name
(RefSeq) probable beta-D-xylosidase 2
  KO
K15920  xylan 1,4-beta-xylosidase [EC:3.2.1.37]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4326722
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.37  xylan 1,4-beta-xylosidase
     4326722
SSDB
Motif
Pfam: Glyco_hydro_3_C Glyco_hydro_3 Fn3-like
Other DBs
NCBI-GeneID: 4326722
NCBI-ProteinID: XP_015630013
UniProt: Q94IY5
LinkDB
Position
1:10871321..10874263
AA seq 818 aa
MAASSSPRRLGFLAALVFAVSVSASVSSVSGGSGPITTNGGNYTRVCDPARFAAAGLDMA
GFPYCDASLPYADRVRDLVGRMTLEEKVANLGDRAGGAPRVGLPRYLWWGEALHGVSDVG
PGGTWFGDAVPGATSFPLVINSAASFNETLWRAIGGVVSTEIRAMYNLGHAELTYWSPNI
NVVRDPRWGRASETPGEDPFVVGRYAVNFVRGMQDIDGATTAASAAAATDAFSRPIKVSS
CCKHYAAYDVDAWNGTDRLTFDARVQERDMVETFERPFEMCIRDGDASCVMCSYNRINGV
PACADARLLTETVRRDWQLHGYIVSDCDSVRVMVRDAKWLGYTGVEATAAAMKAGLDLDC
GMFWEGVHDFFTTYGVDAVRQGKLKESAVDNALTNLYLTLMRLGFFDGIPELESLGAADV
CTEEHKELAADAARQGMVLLKNDAALLPLSPEKVNSVALFGQLQHINATDVMLGDYRGKP
CRVVTPYDGVRKVVSSTSVHACDKGSCDTAAAAAKTVDATIVVAGLNMSVERESNDREDL
LLPWSQASWINAVAEASPSPIVLVIMSAGGVDVSFAQDNPKIGAVVWAGYPGEEGGTAIA
DVLFGKYNPGGRLPLTWYKNEYVSKIPMTSMALRPDAEHGYPGRTYKFYGGADVLYPFGH
GLSYTNFTYASATAAAPVTVKVGAWEYCKQLTYKAGVSSPPACPAVNVASHACQEEVSFA
VTVANTGGRDGTHVVPMYTAPPAEVDGAPRKQLVAFRRVRVAAGAAVEVAFALNVCKAFA
IVEETAYTVVPSGVSRVLVGDDALSLSFPVQIDLQAAA
NT seq 2457 nt   +upstreamnt  +downstreamnt
atggcggcgtcgtcgtcccctcgccgccttgggttcttggccgctctcgtgttcgccgtc
tccgtctccgcctcggtctcctctgtgtccggcggaagcgggccgatcaccaccaatggc
gggaactacaccagggtgtgcgacccggcgaggttcgcggcggcggggctggacatggcc
gggttcccgtactgcgacgcgtcgctgccgtacgcggaccgggtgcgggacctcgtgggg
cggatgacgctggaggagaaggtggccaacctcggcgaccgcgcgggcggcgcgccgcgc
gtggggctgcctcggtacctgtggtggggggaggcgctgcacggcgtgtccgacgtcggc
cccggcgggacgtggtttggcgacgccgtgcccggcgccaccagcttcccgctcgtcatc
aacagcgccgcgtcgttcaacgagacgctgtggcgcgccatcggcggcgtggtgtcgacg
gagatcagggccatgtacaacctgggccacgccgagctcacgtactggagccccaacatc
aatgtcgtccgcgacccgcggtggggccgcgccagcgagacccccggcgaggaccccttc
gtcgtcggccggtacgccgtcaacttcgtccgcggaatgcaggacatcgacggcgccacc
accgccgcatccgccgccgccgccaccgacgcgttctccaggcccatcaaggtgtccagc
tgctgcaagcactacgccgcgtacgacgtcgacgcgtggaacggcaccgaccggctgacg
ttcgacgcgcgcgtccaggagcgcgacatggtggagacgttcgagcggccgttcgagatg
tgcatccgggacggcgacgccagctgcgtgatgtgctcctacaaccgcatcaacggcgtc
ccggcctgcgccgacgcgcgcctcctcacggagaccgtccgccgcgactggcagctccac
ggctacatcgtctccgactgcgactccgtccgcgtcatggtcagggacgccaagtggctc
ggctacaccggcgtcgaggccaccgccgccgccatgaaggccggcctggacctcgactgc
ggcatgttctgggagggcgtccacgacttcttcaccacctacggcgtcgacgccgtccgg
caggggaagctcaaggagtccgccgtggacaacgcgctgaccaacctctacctcacactc
atgaggctcggcttcttcgacggcatcccggagctcgagtccctcggcgccgccgacgtc
tgcaccgaggagcacaaggagctcgccgccgacgccgccaggcaggggatggtgctcctc
aagaacgacgccgcgctgctcccgttgtcgccggagaaggtcaattcggtggcactgttc
gggcagctgcaacacatcaatgccaccgacgtcatgcttggagactacagaggtaagcct
tgcagggtggtgacgccgtacgacggcgtacggaaggtggtcagctcgacgtcggtgcac
gcatgcgacaagggatcgtgcgacacggcggccgcggcggcgaagacggtggacgcgacc
atcgtcgtcgccggcctgaacatgagcgtggagagggagagcaacgacagggaagacctc
ctcctgccgtggagccaggccagctggatcaacgccgtcgccgaggcctcgccgtcgccg
atcgtcctggtgatcatgtccgccggcggcgtcgacgtctccttcgcccaggacaacccc
aagatcggcgccgtcgtctgggccggctaccccggcgaggaaggcggcacggccatcgcc
gacgtgctcttcggaaaatacaatccaggaggaagattgccgctgacgtggtacaagaac
gagtacgtgagcaagatcccgatgacgtccatggcgctgcggccggacgccgagcacggc
taccccggccggacctacaagttctacggcggcgccgacgtgctctacccgttcggccac
ggcctcagctacaccaacttcacctacgcgtcggccaccgccgccgccccggtcacggtc
aaggtcggcgcgtgggagtactgcaagcagctcacctacaaggccggggtgtcctcgccg
ccggcgtgcccggccgtgaacgtggccagccacgcgtgccaggaggaggtcagcttcgcc
gtcacggtggccaacacgggcggcagggacggcacccacgtcgtgccgatgtacacggcg
ccgccggcggaggtggacggcgcgccgcggaagcagctggtggcgttccggcgggtgcgg
gtggccgcgggcgccgccgtcgaggtggccttcgcgctcaacgtgtgcaaggcgttcgcg
atcgtcgaggagacggcgtacaccgtcgtgccgtcgggagtcagcagggtcctcgtcgga
gacgacgcgctgtcgctgtccttccctgttcagatcgacctgcaggcggcagcatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337166
Entry
4337166           CDS       T01015                                 
Name
(RefSeq) beta-D-xylosidase 4
  KO
K15920  xylan 1,4-beta-xylosidase [EC:3.2.1.37]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4337166
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.37  xylan 1,4-beta-xylosidase
     4337166
SSDB
Motif
Pfam: Glyco_hydro_3_C Glyco_hydro_3 Fn3-like
Other DBs
NCBI-GeneID: 4337166
NCBI-ProteinID: XP_015635545
UniProt: Q0J9N5 Q7X6F6
LinkDB
Position
4:complement(32589101..32595888)
AA seq 765 aa
MAMAARGVLAMVVAVAVVWCNNVARAQTPVFACDASNATVSGYGFCDRTKSSAARAADLL
GRLTLAEKVGFLVNKQAALPRLGIPAYEWWSEALHGVSYVGPGTRFSTLVPGATSFPQPI
LTAASFNASLFRAIGEVVSTEARAMHNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPL
LASKYAVGYVTGLQDAGGGSDALKVAACCKHYTAYDVDNWKGVERYTFDAVVSQQDLDDT
FQPPFKSCVIDGNVASVMCSYNKVNGKPTCADKDLLSGVIRGDWKLNGYIVSDCDSVDVL
YNNQHYTKNPEDAAAITIKSGLDLNCGNFLAQHTVAAVQAGKLSESDVDRAITNNFIVLM
RLGFFDGDPRKLPFGSLGPKDVCTSSNQELAREAARQGIVLLKNTGALPLSAKSIKSMAV
IGPNANASFTMIGNYEGTPCKYTTPLQGLGANVATVYQPGCTNVGCSGNSLQLSAATQAA
ASADVTVLVVGADQSVERESLDRTSLLLPGQQPQLVSAVANASRGPVILVVMSGGPFDIS
FAKSSDKISAILWVGYPGEAGGAALADILFGYHNPGGRLPVTWYPASFADKVSMTDMRMR
PDSSTGYPGRTYRFYTGDTVYAFGDGLSYTKFAHSLVSAPEQVAVQLAEGHACHTEHCFS
VEAAGEHCGSLSFDVHLRVRNAGGMAGGHTVFLFSSPPSVHSAPAKHLLGFEKVSLEPGQ
AGVVAFKVDVCKDLSVVDELGNRKVALGSHTLHVGDLKHTLNLRV
NT seq 2298 nt   +upstreamnt  +downstreamnt
atggccatggcggcgaggggagtgttggccatggtggtggcggtggcggtggtgtggtgc
aataatgtggcgagggcgcagacgccggtgttcgcgtgcgacgcgtcgaacgcgacggtg
tccgggtacgggttctgcgaccggacgaagagcagcgcggcgcgggcggcggacctgctg
gggaggctgacgctggcggagaaggtggggttcctggtgaacaagcaggcggcgctgccg
cggctggggatcccggcgtacgagtggtggtcggaggcgctgcacggcgtctcctacgtc
ggccccggcacccgcttctcgacgctcgtccccggcgccaccagcttcccgcagcccatc
ctcaccgccgcctccttcaacgcctccctcttccgcgccattggcgaggtggtgtcgacg
gaggcgagggcgatgcacaacgtcgggctggccgggctcacgttctggagccccaacatc
aacatcttccgcgacccgcggtggggacgcggccaggagacgcccggcgaggacccgctg
ctcgccagcaagtacgccgtcggctacgtcaccggcctccaggacgccggcggcggcagc
gacgcgctcaaggtcgccgcctgctgcaagcactacaccgcatacgacgtcgacaactgg
aagggcgtcgagcgctacaccttcgacgccgtggtgtcccagcaggatctggacgacacg
ttccagcccccgttcaagagctgcgtgatcgacggcaatgtggccagtgttatgtgctcc
tacaacaaggtcaatgggaagcctacctgtgcagacaaggacctcttgtcaggagtcatc
agaggggactggaagctgaacggatacattgtgtcggattgcgattcggttgacgtactg
tacaataaccaacactacaccaagaaccctgaagacgcagctgccatcacaatcaaatca
ggtttggacctgaactgcggcaacttcctggcgcagcacaccgtggcggcggtgcaggcc
gggaagctgtcggagtccgacgtcgaccgggccatcaccaacaacttcatcgtgctcatg
cgactcggcttcttcgacggcgacccgaggaagctccccttcggcagcctcggccccaag
gacgtgtgcacgtcgtcgaaccaggagctggcccgcgaggccgcgcgccagggcatcgtc
ctcctcaagaacaccggcgcgctgccgctctccgccaagtccatcaagtccatggccgtc
attggccccaacgccaatgccagcttcaccatgatcggcaactacgaaggtacgccgtgc
aagtacacgacgccgctccagggcctcggcgccaacgtcgccaccgtgtaccagccggga
tgcaccaacgtcgggtgcagcgggaacagcctccagctcagcgccgccacgcaggccgcg
gcgagcgctgacgtgaccgtgctggtggtcggcgccgaccagtccgtggagcgcgagagc
ctggacaggacgagcctcctcctgccaggacagcagccgcagctcgtctcggctgtcgcc
aacgcctccaggggccccgtcatcctcgtcgtcatgtccggcgggccgttcgacatctcc
ttcgccaagtccagcgacaagatctccgccattctttgggtcggctaccccggcgaagcc
ggtggcgccgccctcgccgacatcctcttcggataccacaatcctggtggaaggttgccg
gtgacgtggtacccggcgtcgttcgccgacaaggtctcgatgaccgacatgcgcatgcgg
ccggactcgtcgaccggctaccccggccggacataccggttctacaccggcgacacggtg
tacgccttcggcgacggcctgagctacaccaaattcgcgcacagcctcgtgtcggcgccg
gagcaggtggccgtgcagctggccgagggccacgcctgccacaccgagcactgcttctcg
gtggaggccgccggcgagcactgcgggagcctgtccttcgacgtccacctccgcgtgcgg
aacgccggcgggatggccggcgggcacaccgtgttcctcttctcgtcgccgccgtcggtg
cacagcgcgccggcgaagcacctgctcgggttcgagaaggtgtcgctggagcccggccag
gccggcgtggtggcgttcaaggtggacgtgtgcaaggacctgagcgtcgtcgacgagctc
ggcaaccggaaggtggcgctgggcagccacacgctgcacgtcggcgacctcaagcacacg
ctcaacctgagggtttaa

DBGET integrated database retrieval system