KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326815
Entry
4326815           CDS       T01015                                 
Name
(RefSeq) heparan-alpha-glucosaminide N-acetyltransferase isoform X1
  KO
K10532  heparan-alpha-glucosaminide N-acetyltransferase [EC:2.3.1.78]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00531  Glycosaminoglycan degradation
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    4326815
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.78  heparan-alpha-glucosaminide N-acetyltransferase
     4326815
SSDB
Motif
Pfam: HGSNAT_cat DUF5009
Other DBs
NCBI-GeneID: 4326815
NCBI-ProteinID: XP_015621257
UniProt: Q5JK28 A0A0P0VCC4
LinkDB
Position
1:complement(40858412..40861916)
AA seq 488 aa
MDGGGQGVARRHGAVAEEDPDRRRGDRSGKEGDDDGVDVDEKAPPPRRTSRRVASLDVFR
GLTVALMILVDGAGGEWPVIGHAPWNGCNLADFVMPFFLFIVGMAIPLSLKRIPDRGRAV
RRVVLRTLKLLFWGILLQGGYSHAPDDLSYGVDMKHVRWCGILQRIALAYLVVAVLEIVT
KNAKVQDQSSSGFSIFRMYFSQWIVACCILVIYLSLVYGIYVPDWDFRVSDVKNPNFGKI
LTVTCGTRGKLSPPCNAVGYIDRKVLGINHMYHRPAWRRHKDCTDDSPHEGPFKTDSPAW
CYAPFEPEGLLSSLSAVLSTIIGVHYGHVLVHMKSHTDRLKQWSIMGITLLILGLTLHFS
HAIPLNKQLYTFSYICVTAGAAGIVFCMFYFLVDILNLHYPFAPLKWTGMNAMLVYVMAA
AGIFEGFLNGWYYEGTNNTLVYWVRKHVFVKVWHSTRVGILLYVLFAQILFWALVAGLLH
RARLYWKL
NT seq 1467 nt   +upstreamnt  +downstreamnt
atggacggcggtggccagggcgtcgcgcggcggcacggcgcggtggcggaggaggatccc
gaccgccgccgcggcgaccgctcggggaaagaaggtgacgacgacggcgtcgacgtcgac
gagaaggcgcctccgcctcgccggaccagcaggcgggtcgcgtcgctcgacgtcttccgt
ggcctcaccgtcgctctgatgatactggtggacggcgccggcggcgagtggccggtgata
ggccacgcgccgtggaacggatgcaacctcgccgacttcgtcatgcccttcttcctcttc
atcgttggcatggctattcccctctccctcaagaggattccagaccgcggtcgagctgtg
aggagagtagtgctcaggacactgaagctgcttttttggggaattctgttgcaaggcggt
tactcccatgcccctgatgatttgtcttatggagttgacatgaagcacgtgagatggtgt
ggtattctccaaaggattgctcttgcatacttggtggttgcagttctagagatcgtaacg
aagaatgcaaaggttcaggaccagtcaagttcgggcttctcgattttcaggatgtacttc
tcccagtggattgttgcatgttgcatccttgtgatctacctgtcccttgtatatgggatt
tatgttcctgactgggatttcagagtgtcagatgttaaaaatccaaacttcggcaaaatc
ttgacggtgacatgtggtacacggggaaaattaagtcctccttgcaatgctgtaggttat
attgaccgtaaagttcttggtatcaatcatatgtaccacaggccagcatggaggaggcac
aaggactgtactgatgattccccacatgagggaccttttaaaactgattccccggcgtgg
tgttatgcaccatttgaacctgaagggttactaagctcactgtccgcggtgttgagtacg
atcatcggggtgcattatgggcatgtgcttgttcatatgaagagccacacggacagacta
aagcagtggtctatcatgggcataactctcctcattcttgggcttactctgcacttttca
catgcaattcctttgaacaagcaactgtacaccttcagttatatctgtgttactgccggt
gcggctggaatcgtgttctgcatgttctacttcctggttgacatcctgaatctgcactac
ccattcgcacccctgaaatggaccggcatgaacgcgatgctggtgtacgtgatggcggcg
gcaggcatcttcgaagggttcttgaacgggtggtactacgagggcaccaacaacacactg
gtttactgggtgaggaagcatgtgttcgtgaaggtgtggcattccacccgtgtgggcatc
ctcctctacgtcctcttcgcgcagatcttgttctgggcccttgtcgccggcctcctccac
cgtgctcgcctctactggaagctctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337855
Entry
4337855           CDS       T01015                                 
Name
(RefSeq) heparan-alpha-glucosaminide N-acetyltransferase isoform X1
  KO
K10532  heparan-alpha-glucosaminide N-acetyltransferase [EC:2.3.1.78]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00531  Glycosaminoglycan degradation
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    4337855
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.78  heparan-alpha-glucosaminide N-acetyltransferase
     4337855
SSDB
Motif
Pfam: HGSNAT_cat DUF5009
Other DBs
NCBI-GeneID: 4337855
NCBI-ProteinID: XP_015637524
UniProt: Q5WMX9 A0A0P0WI56
LinkDB
Position
5:3257538..3262845
AA seq 491 aa
MDAAVVAIAGDGDADAGHRRPLLASADDDDEIRPYPASSPSPQHPAGAERKPRRVASLDV
FRGLTVAMMILVDDAGGAWPGMNHSPWLGVTVADFVMPAFLFIIGVSAALVFKKTPNKTV
ATKKAAIRAIKLFILGVILQGGYIHGRHNLTYGIDLDHIRWLGVLQRIAIGYFLAAISEI
WLVNNISVDSAISFVKKYFMEWIVAVMISALYVGLLLGLYVSNWEFKVQTSNSILTIPTP
GNEIGMKMIQCGVRGSLGPPCNAVGFVDRVLLGENHLYKNPVYKRTKECSVNSPDYGPLP
PNAPDWCLAPFDPEGLLSTLMAAVTCFVGLHFGHVLVHCKDHSPRMLLWLLASTVLTVSG
FLLQLLGMPFSKPLYTVSYMLLTGGVSGFLLLLLYYIVDVINIKKPFILFQWMGMNALIV
YVLAACEIFPTLVQGFYWRSPENNLVDLTESLLQTIFHSKRWGTLAFVVLEIIFWCLAAC
FLHMKGIYLKL
NT seq 1476 nt   +upstreamnt  +downstreamnt
atggacgccgccgtcgtcgccatcgccggcgacggggacgccgacgccggccaccgccgt
cctctcctcgcctccgccgacgacgacgacgagatccgcccctaccccgcatcatcccct
tcgccgcagcacccggcgggggctgagcggaagccgcggcgggtcgcctcgctcgacgtg
ttccgcggcctcaccgtcgccatgatgatactggtggacgacgccggcggggcgtggccg
gggatgaaccactcgccgtggctcggggtgacggtggccgacttcgtcatgcccgccttc
ctcttcatcatcggcgtctccgccgccctcgtcttcaagaaaacaccaaacaaaacagtg
gcaactaagaaggctgcaatcagggccatcaaacttttcatcttgggtgtaattttgcaa
ggaggatatattcatggcagacacaatttaacttatggcattgatttggatcatattcga
tggctaggtgtgctgcagaggatagctattggatactttctagcggcaatttcagagatt
tggcttgtcaacaatatttcagtggattcagctatatcatttgtgaagaaatacttcatg
gagtggatcgtggccgtaatgatttcagcactttatgttggcttgctactcggcctttat
gtttcaaattgggaatttaaagttcaaactagcaattcaatccttacaattccaactccg
ggcaacgaaattggaatgaaaatgatccagtgtggagttagaggtagtcttgggccacct
tgcaatgcagttggatttgtagatcgagttttacttggtgaaaatcacctgtacaagaac
ccagtctataaaaggactaaggaatgcagtgttaactctcctgattatggaccacttcct
ccaaatgcaccagactggtgcctggctccatttgatcccgagggtttgctaagtacattg
atggctgcagtgacttgctttgttggattgcattttggacatgttttggttcattgcaag
gatcattcacctcgaatgctattatggctactagcttccactgtgttaacagtctcagga
tttctacttcagttattaggcatgcctttcagcaagcctttgtacacggtgagctacatg
ctactaaccggtggggtatctggattcctgctgttgttgctatactacattgttgatgtc
atcaatatcaagaagccgttcatcctattccagtggatgggcatgaacgcgcttatagtg
tatgttcttgctgcttgtgagatcttccctacacttgtgcaagggttctattggagatca
cctgaaaacaacctggtggatttgactgaatctctgcttcagacaatcttccactccaaa
cgctggggaaccttggcgttcgtcgtcttggagatcatcttctggtgcctggctgcttgt
ttcctccacatgaaaggcatatacttgaaactgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9271178
Entry
9271178           CDS       T01015                                 
Name
(RefSeq) heparan-alpha-glucosaminide N-acetyltransferase
  KO
K10532  heparan-alpha-glucosaminide N-acetyltransferase [EC:2.3.1.78]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00531  Glycosaminoglycan degradation
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    9271178
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.78  heparan-alpha-glucosaminide N-acetyltransferase
     9271178
SSDB
Motif
Pfam: HGSNAT_cat DUF5009 Atthog
Other DBs
NCBI-GeneID: 9271178
NCBI-ProteinID: XP_015616552
LinkDB
Position
11:complement(7832202..7835998)
AA seq 496 aa
MEKGQEIGASAGEKGSEQHAIDVRPGEHGAIGVVAGAAAEAPEKERLAVVEEEPRKKSKR
VAALDAFRGLTIVLMILVDDAGGAYERMDHSPWNGCTLADFVMPFFLFIVGVAIAFALKR
VPKLGAAVKKITIRTLKMLFWGLLLQGGYSHAPDDLSYGVDMKKIRWCGILQRIALVYFV
VALIEAFTTKVRPTTVRSGPYAIFHAYRWQWLGGFVALFIYMVTTFSLYVPDWSYVYHND
GDVNDGKQFTVQCGVRGHLDPACNAVGYVDRVVWGINHLYTQPVWIRSKDCTFSSPRAGP
LRADAPAWCLGPFEPEGLLSSISSILSGTIGIHYGHVLVHFKTHRERLRHWLLLGFSLLA
LGILLHFTNAIPINKQLYSLSYVCFTAGAAGVVLSAFYILIDVWGLRTPFLFLEWIGMNA
MLVFVLAAQAIFPAFVNGWYYDSPGNTLVSWIQKHVFINVWHSQRLGTLLYVIFGEIVFW
GVVSGILHKLGIYWKL
NT seq 1491 nt   +upstreamnt  +downstreamnt
atggagaaggggcaggagataggagcgtcagccggcgagaaaggttcagagcagcacgcc
attgacgtccgccccggcgagcatggcgccatcggagtcgtcgccggcgccgctgcagaa
gcaccggagaaggagagattggctgttgttgaagaggagcccaggaagaaaagcaagagg
gttgcagctcttgatgcctttagagggctaaccattgtgctaatgatactggtggatgat
gccggtggggcttacgagcggatggaccattcaccatggaacggatgcaccttggcagat
ttcgtcatgcccttcttcctcttcatcgtcggcgtcgcaatcgccttcgcgttgaagaga
gttccaaagttgggtgcagctgtgaagaagatcaccatcagaacactgaaaatgctcttc
tggggcctgctactgcaaggtggatattcacatgcaccggatgacctgtcttatggggtg
gatatgaagaagataagatggtgtggcatcctccagaggatagctttggtgtacttcgtg
gttgctctgatagaggcattcaccacaaaagttcggcctacgacagtgcggtccggtcca
tatgcaatcttccacgcataccgatggcaatggctaggcggttttgtcgcgttattcatt
tacatggtcaccacattctctctatatgtcccggattggagctatgtctaccacaacgat
ggcgatgttaatgacgggaagcaatttacggtacaatgtggtgtgagaggtcatctggac
cctgcctgcaacgcagttggttatgttgatagggtggtttggggaatcaatcatctctac
acgcagccagtttggatccgatcaaaggattgtacatttagctcaccaagggcaggtcct
ctccgagctgatgctccagcatggtgtcttgggccttttgaaccagaaggcttattaagt
tcaatatcatcgattctgtcagggacaattgggatccattatggacatgttctcgttcat
ttcaagacccacagagagagactgagacactggcttctgctgggattttctctccttgca
ctcggcattcttctccacttcacaaatgccattccaatcaacaagcaactctacagctta
agctatgtctgcttcacggctggtgcagctggagtagttctttcagctttctacatattg
attgatgtctggggactaagaacaccattcttgttcctggagtggattggcatgaatgcc
atgcttgtgtttgttctagcagcacaggcaatatttccagcatttgtcaatggatggtac
tatgattcaccaggcaatactcttgttagctggatccagaagcatgtgtttatcaatgta
tggcactcacaaaggttgggaacactgctgtatgtcatatttggggagattgtcttctgg
ggtgttgtgtcaggcatcttgcacaagctgggaatttattggaaactatga

DBGET integrated database retrieval system