KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326817
Entry
4326817           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC4326817
  KO
K13511  monolysocardiolipin acyltransferase [EC:2.3.1.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4326817
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4326817
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-
     4326817
Lipid biosynthesis proteins [BR:osa01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   4326817
SSDB
Motif
Pfam: Acyltransferase GvpK
Other DBs
NCBI-GeneID: 4326817
NCBI-ProteinID: XP_015621774
UniProt: A0A0N7KEC6 Q5JK26
LinkDB
Position
1:complement(40864920..40868408)
AA seq 507 aa
MAPMAGGGGVPWGDRARVVGAQIRSRFRVGVAPVDRRWLWRRGDGRVASEAVRQWTERVR
SLWQREKSTDQISSSPGTSQVAAAAKPSSSALRFYRKKVGKEVDGIEDSVIFRSLQALAV
PLIGNACHIFMHGLNSVQIYGAEKLQQALQERPKGKPLLTVSNHVAAMDDPFVIASILPP
SVMLEAQKLRWTLCASDRCFTNPILSTFFRSVKVLPVSRGDGIYQKGMDMALSKLNNGGW
VHIFPEGSRSKDGGKTVAPAKRGVGRLVMDADSLPVVIPFVHTGMQDIMPVGKRIPRAGK
RVIVVVGDPINFNDLIIDNSDETQHISRGILYDKATERIGQRLQELKAEVDRLAAEQKSE
LQHHHARDTVNYGTRLWQQVDWEAFGMESSMLSPEPSDVQEPLKKAKPVLHLESEHAKPE
LHLEPEQAKHELHTEQCVPAAPSAEICSNFGVPLFFRQHTDPSELMGFAARGLLKNGRFM
EEEGYRELQRQGAMNMFWGSQANNTVL
NT seq 1524 nt   +upstreamnt  +downstreamnt
atggccccaatggcgggcggcggcggggtaccgtggggggaccgggccagggtggtcggg
gcgcagatccgcagcaggttccgcgtcggcgtggcgcccgtggaccggcggtggctgtgg
cggcgcggggacgggcgcgtcgcctccgaggcggtccggcagtggacggaacgcgtgcgg
agcctgtggcagagggagaagagtacggatcagatctcctcgtctccggggacgtcccag
gtggcggccgcggcgaagccatcatcgagtgctttgaggttctacagaaagaaagtgggc
aaggaggttgatggaattgaagattctgttatttttcggtcgcttcaagcattggctgtt
cctcttattggcaatgcttgtcatatttttatgcatggcctcaactctgttcagatttat
ggtgcagagaaacttcagcaggcattacaggagagacctaaaggcaagcctctcctaacg
gtcagcaatcatgtggcagctatggatgatccctttgtaattgcgtcaattctcccacca
tcagtcatgttggaagctcaaaagctgagatggacattatgtgcgagtgatcgttgcttt
acaaatccaattttgtctacattcttcaggtctgttaaagtgctacctgtttctcgtggc
gatggcatctaccaaaagggaatggacatggcactttcaaagttgaacaatggtggatgg
gttcatattttcccagaaggaagtcgttcaaaggatggagggaaaaccgtcgctcctgcc
aagagaggtgttggaagattggtaatggacgctgacagccttccagttgtaatacccttt
gtccatacaggaatgcaggatataatgcctgtcggaaaacgtattccaagagcaggcaaa
agggtgattgtggttgttggtgatccaatcaacttcaacgaccttatcattgacaacagc
gatgaaacccaacacatctctagaggcattttgtatgacaaagcaacagaaaggattggg
cagagactgcaggaactgaaagccgaagtcgatagattagcagcagagcagaaatctgaa
ctccaacatcatcatgcccgtgatactgtcaactatggtacccgactgtggcagcaggtt
gattgggaagcatttggcatggagagttcaatgctgtcaccagaaccttcagacgtgcaa
gagccgttgaagaaagccaagcctgtactacacctggaatctgaacatgccaagcctgaa
ctacacctggaacctgagcaagccaagcatgagctacacacggaacaatgcgttcctgca
gctccaagtgccgagatctgctccaatttcggtgttccgctcttcttcagacagcacacg
gacccttctgagctcatggggtttgccgcccgtggcctgctcaagaatggcaggttcatg
gaggaggaaggctaccgggaattgcaacggcagggcgcaatgaacatgttttggggatct
caggccaacaatactgtactatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327848
Entry
4327848           CDS       T01015                                 
Name
(RefSeq) probable 1-acyl-sn-glycerol-3-phosphate acyltransferase 5
  KO
K13513  lysocardiolipin and lysophospholipid acyltransferase [EC:2.3.1.- 2.3.1.51]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa00564  Glycerophospholipid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4327848
   00564 Glycerophospholipid metabolism
    4327848
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4327848
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.51  1-acylglycerol-3-phosphate O-acyltransferase
     4327848
    2.3.1.-
     4327848
Lipid biosynthesis proteins [BR:osa01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   4327848
SSDB
Motif
Pfam: Acyltransferase Acyltransf_C
Other DBs
NCBI-GeneID: 4327848
NCBI-ProteinID: XP_015622067
UniProt: A0A8J8YM00 Q0JIR6
LinkDB
Position
1:complement(33154298..33158322)
AA seq 399 aa
MNGSSGSQGHNVNGGQKKVQHASPLTLNNGSKHRPLTPMRRCRGVACVVIILSTAFTLIV
FIAPITTFLVRLVSVHYSRKATSVLFGMWLSLWPFLFEKINKTNVVFSGESVLPKKRVLL
FANHRTEVDWMYLWDLALRKGYLGYIKYILKSSLMKLPVFSWAFHIFEFIPVERKWEIDE
AIIQNKLSAFKDPRDPLWLAVFPEGTDYTEKKCIKSQEYASEHGLPILKNVLLPKTKGFL
CCLQELKSSLDAVYDVTIAYKHRLPDFLDIIYGTDPSEVHIHIRTVKLCDIPTSEDEVTD
WMIERFRQKDQLLSDFFMQGHFPDEGTEGDVSTPECLANFIAIVSSTGFFLYLSLFSSVW
FKVYVLLSCAYLTFVTYFSIQPPQLICSSEGGTHAKKVL
NT seq 1200 nt   +upstreamnt  +downstreamnt
atgaatggttcaagtggctcccaaggacataatgtcaatggaggacagaagaaagtgcag
catgctagcccactcactctgaacaatgggtcaaagcaccgtccattgactcccatgaga
cgatgccgcggtgtagcatgtgtggtgatcatactgtcaacagcattcacattgatagtt
ttcatagcccctattactactttccttgttcggctagtcagcgtgcattacagtagaaag
gcgacctctgttctgtttggaatgtggctatctttatggccattcttgtttgagaagatc
aacaagaccaatgtggttttctctggtgaaagtgtacttccaaaaaagcgtgtcttgtta
tttgccaaccacaggactgaggttgactggatgtatttgtgggatcttgcattgaggaaa
ggctatttaggatatatcaagtacatccttaagagcagcttgatgaaattgcctgttttt
agctgggcatttcacatttttgagtttatcccagtagaacggaaatgggagattgatgaa
gcaattatccagaacaaactgtcagcatttaaggaccccagagaccccctctggttggcc
gttttccctgagggcactgattatactgagaagaaatgcatcaagagtcaagaatatgct
tcggagcatggtctgcctatacttaaaaatgttcttcttccaaagacaaaggggttcctt
tgctgtttgcaagagttgaagagctccctagatgcagtttatgatgtcacaatagcgtat
aagcatcgcctgccagattttctggatattatatatggcaccgatccttctgaagtccac
atccacatcagaactgttaagctctgtgacattccaacgtcagaagatgaagtaaccgat
tggatgatagagaggttcaggcagaaggaccagcttctgtcagattttttcatgcaaggc
cacttccctgatgaaggaactgaaggggatgtatccacaccggagtgccttgctaatttc
attgcaatagtcagctcgacaggcttcttcttgtacctatctcttttttcgtctgtgtgg
ttcaaggtctatgtattattaagctgcgcttaccttacatttgttacctatttctccatt
caaccaccccaactgatatgctcatcagagggtggaacccatgccaaaaaggtactgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337323
Entry
4337323           CDS       T01015                                 
Name
(RefSeq) N-acylphosphatidylethanolamine synthase
  KO
K13511  monolysocardiolipin acyltransferase [EC:2.3.1.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4337323
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4337323
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-
     4337323
Lipid biosynthesis proteins [BR:osa01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   4337323
SSDB
Motif
Pfam: Acyltransferase
Other DBs
NCBI-GeneID: 4337323
NCBI-ProteinID: XP_015633927
LinkDB
Position
4:complement(34054302..34058178)
AA seq 296 aa
MEMEASAAEGGAAAAARTLRWAGRAGHLGGFPRAAVIAAVGAVAKAYASLLNTTTVHNAD
ALLRLVSSRPPGTPLLTVSNHMSTMDDPLMWGFKGFPTTDAKLQRWVLTAEDICFRNVFM
SYIFRLGKCVPITRGAGIYQDHMTEALEVLSTGDWLHSFPEGKIAQDDQPIRRLKWGTAS
LIVRAPVTPIVLPIVHSGFEKVMPEKSFFGRRPPVPLWNKEIHIIVGEPVEFDLPSLKQA
ARTVPQDSSFERKGWPSIMPDGLDEAAQRWLYQKISDKIQSVMETLRKRLLDLKQH
NT seq 891 nt   +upstreamnt  +downstreamnt
atggagatggaggcgtccgccgccgagggcggagccgcggcggcggcgcggacgctgcgg
tgggcggggcgcgcggggcacctcgggggattcccgcgcgccgcggtgatcgccgccgtc
ggggcggtcgccaaggcgtacgcgtcgctgctcaacaccaccaccgtccacaacgccgat
gccctcctccgcctcgtctcctcgcggccccccggcacgccgctcctcaccgtcagcaac
cacatgtcaacgatggatgacccacttatgtggggattcaagggttttccaactacagat
gccaaacttcaaagatgggtgttgacagcagaggacatctgcttcaggaatgtgttcatg
tcttacatatttcgacttgggaaatgtgtgccgatcacacgaggtgctggaatttatcag
gatcatatgactgaagcccttgaagtgcttagcactggagactggttgcattcattccct
gaaggaaaaatagctcaagatgatcagccaatcagacgtctgaagtggggaactgccagt
cttatcgtccgagcaccagtaactccaattgttttgcctattgtgcattctggctttgaa
aaggtcatgccagagaaatcattttttgggcgtcgaccgccagtgcctctttggaacaag
gagatacatatcatcgttggagagccagtggagtttgatctgccaagcttgaagcaggca
gcaagaacagtacctcaggattcatcttttgaaaggaagggttggccaagcatcatgcca
gacggactagatgaagcggctcagagatggctttaccagaagatatcagataagatccaa
tcagttatggagacattgcggaagagacttctcgacctgaagcaacattga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339242
Entry
4339242           CDS       T01015                                 
Name
(RefSeq) probable 1-acyl-sn-glycerol-3-phosphate acyltransferase 5
  KO
K13513  lysocardiolipin and lysophospholipid acyltransferase [EC:2.3.1.- 2.3.1.51]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa00564  Glycerophospholipid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4339242
   00564 Glycerophospholipid metabolism
    4339242
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4339242
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.51  1-acylglycerol-3-phosphate O-acyltransferase
     4339242
    2.3.1.-
     4339242
Lipid biosynthesis proteins [BR:osa01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   4339242
SSDB
Motif
Pfam: Acyltransferase Acyltransf_C
Other DBs
NCBI-GeneID: 4339242
NCBI-ProteinID: XP_015638306
UniProt: A0A0N7KL18 Q60EI7
LinkDB
Position
5:24724315..24727260
AA seq 397 aa
MMNGSNGSQGYHVNGKQVQSVVPSIQNNGPRHRPLTLMRRCRGMLCLVIMPLTAFMMMVY
LSPVTTFLIRLFSVHYSRKSTCFLFGMWLAMWPFLFEKINKTKFVFSGETVPPKERVLLF
ANHRTEVDWMYLWDLALRKGRLQCIKYILKKSLMKLPIFNWAFHIIEFIPVERKWEVDEP
LIRSRLSELKNPKDPLWLAVFPEGTDYTEKKCIKSQEYAKEHGLPILNNVLLPKTKGFHC
CLQELRDSMDSVCDITIAYKHRPPTFMDNVYGIDPSEVHIHVKIIQVSDIPTSEDEVADW
LIERFKLKNKLLSDFSALGHFPNEGTEDDLSTLKCIANFVAVISTTTVLTYLTLFSSVWF
KIFVAFSSAFLTFATLYSIHLPQLICSPEAGTHAKKS
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgatgaatggttcaaatggttcccaagggtatcatgtgaatggaaagcaagtgcaaagc
gttgttccttccattcagaacaatggaccaagacaccggccattgactctaatgagacgg
tgccgtggcatgttatgtttggttattatgccgttgacagcatttatgatgatggtttac
ctatcccctgtaactactttcctcatacggttgttcagtgtgcattacagcagaaagtcg
acatgctttctgtttgggatgtggttagcaatgtggccatttttgtttgagaagattaac
aagaccaagtttgttttctctggcgaaactgtgcccccaaaagagcgtgtcttgttattt
gctaatcacagaaccgaggttgattggatgtacttgtgggatcttgcgttgaggaaaggc
cgtttgcagtgcatcaagtatatccttaagaaaagcttgatgaagttgcctatttttaac
tgggcatttcacattattgaatttattccagtagagcggaagtgggaggttgatgaacca
ttaatccgaagtagactttcggaattaaagaaccctaaggatcccctttggttggcagtt
ttccctgaaggcacggattacacggagaaaaagtgtatcaagagtcaagagtatgcaaaa
gagcacggattgcctattctgaataatgtcctccttcccaagacaaagggttttcattgc
tgtctacaagagttgagggactccatggattctgtttgtgacatcacaatcgcatataag
catcggccaccgacttttatggacaatgtttatggtattgatccttctgaagttcacata
catgttaaaatcattcaagtctctgacatacccacctcagaagatgaagtcgccgattgg
ctgatcgagagatttaaactgaagaacaagcttctgtctgatttctcggcacttggccat
ttccccaacgaaggaactgaagatgatctgtccacactcaagtgcatcgcgaattttgta
gcggtaatcagcacaacgaccgtcctcacgtacctgaccctgttctcgtctgtatggttc
aagattttcgtagcatttagctctgctttccttacttttgcaaccttatactccatacat
ctgccccagctgatatgctccccggaagctggtacccatgccaagaaatcctga

DBGET integrated database retrieval system