KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326849
Entry
4326849           CDS       T01015                                 
Name
(RefSeq) dihydrolipoyl dehydrogenase 1, chloroplastic
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00020  Citrate cycle (TCA cycle)
osa00260  Glycine, serine and threonine metabolism
osa00280  Valine, leucine and isoleucine degradation
osa00310  Lysine degradation
osa00380  Tryptophan metabolism
osa00620  Pyruvate metabolism
osa00630  Glyoxylate and dicarboxylate metabolism
osa00640  Propanoate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01240  Biosynthesis of cofactors
Module
osa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
osa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
osa_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
osa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
osa_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4326849
   00020 Citrate cycle (TCA cycle)
    4326849
   00620 Pyruvate metabolism
    4326849
   00630 Glyoxylate and dicarboxylate metabolism
    4326849
   00640 Propanoate metabolism
    4326849
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4326849
   00280 Valine, leucine and isoleucine degradation
    4326849
   00310 Lysine degradation
    4326849
   00380 Tryptophan metabolism
    4326849
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4326849
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     4326849
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   4326849
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox FAD_binding_2 GIDA FAD_oxidored Lys_Orn_oxgnase Pyr_redox_3 Thi4 UDPG_MGDP_dh_N DAO
Other DBs
NCBI-GeneID: 4326849
NCBI-ProteinID: XP_015625013
UniProt: A0A0N7KCW5 Q94CN9
LinkDB
Position
1:13272604..13282036
AA seq 561 aa
MYSTAISLSAAATAAAAVGGARPGAIRPAELRFCGLRREALGLRSLRAPPRAAATPRKAA
AATGNGAAGSGGFDYDLVIIGAGVGGHGAALHAVEKGLKTAIIEGDVVGGTCVNRGCVPS
KALLAVSGRMRELQDEHHMKSLGLQVSTAGYDRQAVADHANNLASKIRSNLTNSMKALGV
DILTGFGTIVGKQKVRYGKVGFPDNEITARNIIIATGSVPFVPNGIEIDGKTVFTSDHAL
KLESVPDWIAIVGSGYIGLEFSDVYTALGSEVTFVEALDQLMPGFDPEIAKLAQRILINP
RKIDYHTGVFASKITPAKDGKPVLIELIDAKTKEHKETLEVDAALIATGRAPFTKGLGLE
NVNVVTQRGFVPVDERMQVMDADGNAVPNLYCIGDANGKLMLAHAASAQGISVVERISGK
DNILNHLSIPAACFTHPEISMVGLTEPQAREKADKEGFEISVVKTSFKANTKALAENEGD
GLAKMIYRPDTGEILGVHILGLHAADLIHEASNAIALGTRVQDIKFAVHAHPTLSEVLDE
LFKAAKVNAGVPHSVNEPVAA
NT seq 1686 nt   +upstreamnt  +downstreamnt
atgtactccacggctatctcgctctccgccgccgccaccgccgccgcggcggtcggcggc
gcccggccaggcgcgatccggccggcggagctccgcttctgcggcctccgccgcgaggcc
ctcgggctccgctcgctgcgggccccgccgcgagcggccgccacgccgcggaaggcggcg
gcggctactgggaatggtgcggccgggagcggcgggttcgactacgacctcgtgatcatt
ggggcgggcgtcggcgggcacggcgcagctctccacgccgtcgagaagggtctgaaaact
gccataattgagggggatgttgtaggtgggacttgtgtgaacagaggttgtgttccgtcg
aaggcacttcttgctgtcagcggtcggatgagggaacttcaagatgaacaccacatgaaa
tcgttgggtctacaggtttcaacagctggatatgataggcaggctgttgcagatcatgca
aataatctggcctctaaaattcgtagcaacttgactaattcgatgaaagctttgggtgtg
gatatattgactggttttggcaccattgtgggaaaacaaaaagtgagatatggaaaagtt
ggttttcctgacaatgaaatcactgccagaaatatcattattgcaacggggtctgttcct
tttgtccccaatggcatcgaaatagatggtaaaaccgtatttactagtgatcatgcacta
aaacttgagtcagttcctgactggattgctatcgtgggaagcggttacattggactggaa
ttcagtgatgtatacacggctctgggaagtgaggttacttttgttgaagcacttgatcag
ttgatgcctggttttgatcctgagattgcaaaattggcccaaaggattcttatcaatcct
cgtaaaattgactatcatactggggtctttgcgagcaagattaccccagcaaaggatggt
aaacccgtgttgattgagttaattgatgctaagacaaaggaacacaaggaaacacttgag
gtggatgcagctctcatagctaccggaagggcaccgttcaccaaagggcttggcttggaa
aatgtcaacgttgttacacaacgcggttttgttcctgttgatgagcggatgcaagttatg
gacgcagatggcaatgcggttccaaatttgtattgtattggagatgccaatggcaaactc
atgctggctcatgctgccagtgcacaaggaatctcagttgttgagcgaatctctgggaaa
gacaacatcctaaatcatctaagcatcccggctgcctgtttcactcatccggagattagt
atggttgggctaacagagccacaagcgagagaaaaggctgataaggaaggatttgagata
agtgttgttaagaccagcttcaaggcaaacacgaaggctctggctgagaatgaaggagat
ggacttgctaagatgatttaccggcctgacactggagaaattcttggagttcacatatta
ggtttgcatgctgctgacctcatccacgaggcatcaaacgccattgccctcggaactcgt
gtacaagacatcaagtttgctgttcatgcacacccaactttgtctgaggttctggatgag
ctcttcaaagctgccaaggttaatgcaggtgttcctcattccgtaaatgagcccgtcgca
gcctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326980
Entry
4326980           CDS       T01015                                 
Name
(RefSeq) dihydrolipoyl dehydrogenase 1, mitochondrial
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00020  Citrate cycle (TCA cycle)
osa00260  Glycine, serine and threonine metabolism
osa00280  Valine, leucine and isoleucine degradation
osa00310  Lysine degradation
osa00380  Tryptophan metabolism
osa00620  Pyruvate metabolism
osa00630  Glyoxylate and dicarboxylate metabolism
osa00640  Propanoate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01240  Biosynthesis of cofactors
Module
osa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
osa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
osa_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
osa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
osa_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4326980
   00020 Citrate cycle (TCA cycle)
    4326980
   00620 Pyruvate metabolism
    4326980
   00630 Glyoxylate and dicarboxylate metabolism
    4326980
   00640 Propanoate metabolism
    4326980
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4326980
   00280 Valine, leucine and isoleucine degradation
    4326980
   00310 Lysine degradation
    4326980
   00380 Tryptophan metabolism
    4326980
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4326980
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     4326980
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   4326980
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox FAD_oxidored Pyr_redox_3 GIDA FAD_binding_2 NAD_binding_8 AlaDh_PNT_C DAO Thi4 HI0933_like 3HCDH_N FAD_binding_3 UDPG_MGDP_dh_N Lycopene_cycl Trp_halogenase
Other DBs
NCBI-GeneID: 4326980
NCBI-ProteinID: XP_015611017
UniProt: A0A0P0V236
LinkDB
Position
1:complement(12654851..12658470)
AA seq 503 aa
MALAILARRRAAEALLRRPLGAAGVSALRASYAAVAGEESDVVVVGGGPGGYVAAIKAAQ
LGLKTTCIEKRGTLGGTCLNVGCIPSKALLHSSHMYHEAKSSFAHHGVKFSNLEVDLPAM
MAQKDKAVAGLTKGIEGLFKKNKVTYVKGFGKLASPSEVSVDLSDGGSTVVKGKNIIIAT
GSDVKSLPGVTIDEKKIVSSTGALCLSEIPKKLVVIGAGYIGLEMGSVWNRLGSEVTVVE
FAPDIVPSMDGEVRKQFQRMLEKQKMKFMLKTKVVGVDTSGDGVKLTLEPAAGGEQSVIE
ADIVLVSAGRVPYTAGIGLESVGVETDKAGRILVDKRFMTNVNGVYAIGDAIPGPMLAHK
AEEDGVACVEFIAGKEGHVDYDTVPGVVYTHPEVASVGKTEEQVKALGIPYRVGKFPLLA
NSRAKAIDDAEGLVKVVAEKETDKILGVHIMAPGAGEIIHEAVLALQYGASSEDIARTCH
AHPTVSEALKEACLQTFTKAIHI
NT seq 1512 nt   +upstreamnt  +downstreamnt
atggcgctcgcaatcctggcgaggaggcgggcggcggaggcgctgctgcggcggccgctg
ggggcggcgggggtgtcggcgctgagggcgtcgtacgcggcggtggcgggggaggagagc
gacgtggtggtggtgggcggcgggccgggagggtacgtggcggcgatcaaggcggcgcag
ctggggctcaagaccacctgcatcgagaagaggggcaccctcggcgggacatgcctcaac
gtcggctgcatcccctccaaggctctgttgcactcatctcatatgtaccatgaagcaaaa
agttcctttgcacaccatggagtgaaattttccaatctggaggtagacctcccagctatg
atggcacagaaagacaaggctgtggcaggcctgactaaggggattgaaggtctcttcaag
aagaacaaagtgacgtatgtcaaaggctttgggaaacttgcttcgccctcagaggtgtct
gttgatctgagcgatggtggcagcacagttgtcaaagggaaaaacataatcattgctaca
gggtctgatgtaaaatcactccctggagtcacaattgatgagaagaaaatcgtctcatct
actggggccttgtgcttgtcagagattccaaagaaattggtggttattggagcaggttac
attggtctggagatgggttcggtctggaaccgccttggttcagaggtcaccgttgttgaa
tttgccccagatatagttccatcaatggatggtgaagtcaggaagcagttccagcgcatg
ttggagaagcagaagatgaagttcatgctcaagacaaaggtagttggggttgatacctcc
ggagatggtgtgaagctaacacttgaacctgcagctggaggtgagcagagtgtcattgaa
gctgatattgtattggtttctgctggaagagtcccatatactgctggtattgggttggaa
agtgttggtgttgagacagacaaagctggcaggatcctcgtggataagcgcttcatgact
aacgtcaatggagtctatgcaattggggatgccatccctgggcccatgcttgcccacaaa
gctgaagaggatggtgttgcctgtgttgagttcattgctggcaaggaggggcacgtcgac
tatgacacagtgcctggtgtggtctatacacatccagaggtcgcgtctgttggaaagact
gaagagcaggtgaaagctttaggaattccctaccgtgttggcaaatttccgctgttggca
aacagccgtgcaaaggccattgacgatgctgagggcttggtgaaggtggtggctgagaag
gaaactgacaagattctgggcgtgcatatcatggctcccggtgctggagagataatacat
gaggctgtccttgctttgcagtatggagcatcaagtgaggacatagctcgtacatgccac
gctcatcccaccgtgagcgaagccttgaaggaggcctgcctgcaaaccttcacaaaggcg
attcacatttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328010
Entry
4328010           CDS       T01015                                 
Name
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 2 of pyruvate dehydrogenase complex, mitochondrial
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00020  Citrate cycle (TCA cycle)
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4328010
   00020 Citrate cycle (TCA cycle)
    4328010
   00620 Pyruvate metabolism
    4328010
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     4328010
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 ACT
Other DBs
NCBI-GeneID: 4328010
NCBI-ProteinID: XP_015627700
UniProt: B9F1Q4 Q6YPG2
LinkDB
Position
2:287571..294041
AA seq 548 aa
MSAAHLLRHSRKLRTLRDALDYDRSALVRYFSAASASFPTKGGAAAGVEKRIGGARFPQC
KQPGKELETFKVSLGGLNGRYACRRAPNNCIPTTITGLNGSLSCGQVSSARSFSSSADLP
PHQEIGMPSLSPTMTEGNIARWLKKEGDKVSPGEVLCEVETDKATVEMECMEEGYLAKII
HGDGAKEIKVGEIIAVTVEEEGDLEKFKDYKPSTSAAPAAPSEPKAQPEPAEPKVKETEP
SRTPEPKAPKTEEASQPGGRIFSSPLARKLAEDNNVPLSSVMGTGPDGRILKADIEDYLA
SVAKGGKREALAAPGLSYTDVPNTQIRKVTANRLLSSKQTIPHYYLTVDARVDNLIKLRG
ELNPLQESSGGKKISINDLVIKAAALALRKVPQCNSSWMSDFIRQYHNVNINVAVQTEHG
LFVPVIRDADKKGLGTIAEEVKQVAQRARDNSLKPEDYEGGTFTISNLGGPFGIKQFCAI
INPPQSAILAIGTAEKRVIPGSVDGQYEFGSFMSATMSCDHRVIDGAIGAEFLKAFKGYI
ENPNSMLL
NT seq 1647 nt   +upstreamnt  +downstreamnt
atgtctgcggcgcacctcctccgccactcccgcaagctgcggactctacgtgatgctcta
gattatgatcggtctgctcttgtacgctacttctccgctgcttctgcatcctttcccaca
aagggaggtgctgctgctggtgttgagaaaagaattggtggcgccagattccctcagtgc
aagcagcctgggaaagagcttgagaccttcaaggtgtcactaggaggactaaatggaaga
tatgcttgtagaagagcacctaacaattgtatcccaaccactattaccggtctcaacggt
tcattgtcatgtggacaggtgtcttcagcaagatctttctcaagcagtgcagacctgcca
ccacatcaggaaattgggatgccatcactctctcctacaatgactgaggggaacattgca
aggtggctgaagaaggaaggagataaggtctcacctggtgaagttctctgtgaggtggag
acggataaagccactgtagagatggagtgcatggaagagggctatctcgctaagatcatt
catggagatggtgccaaagagatcaaagttggtgagatcattgctgtaactgtggaagaa
gagggtgaccttgagaagtttaaggattataaaccttcaacttcagctgcacctgcagcc
ccttctgaaccgaaggctcagcctgagcctgcagagccaaaggtgaaggagacagagcct
tccaggactcctgagccgaaagccccaaagactgaagaagcttctcaaccagggggtcga
atattctccagccctcttgcaagaaaattggcagaagataacaatgttccactgtcaagc
gtaatgggaactggtcctgatgggcgaattttgaaggcggacattgaagattacttggct
tctgtagcaaagggtggcaaaagggaagctcttgcggctccagggttaagttacactgat
gttcctaatactcagataagaaaggttactgcaaaccgcctgctaagctctaaacaaact
attcctcattattacttgacagttgacgcccgtgttgataatcttatcaagttgcgaggg
gaactgaatccgttgcaagagtcatctggcggtaagaagatatctattaacgatcttgtt
ataaaggctgcagctctggctcttcgaaaggtccctcagtgtaatagctcgtggatgagt
gattttatccgccaataccacaacgtgaacatcaatgttgctgtacagactgagcatggg
ttgtttgttccagtaattagggatgcagacaagaagggacttggtacaattgctgaggag
gtgaagcaggtggctcaaagagcaagggataacagcttaaaacctgaagattatgaggga
ggcacattcaccatatcaaacctaggaggtcctttcggaatcaaacaattctgtgccatc
ataaatcctcctcagtcagcaatcttggccattggtactgctgagaagagggtgatacct
ggcagcgtagacggccagtatgagtttggttccttcatgtcggcaacaatgagctgtgat
cacagggttattgatggtgctatcggcgcagaatttctgaaagcattcaagggctatatc
gagaatccaaactcaatgttactgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330673
Entry
4330673           CDS       T01015                                 
Name
(RefSeq) pyruvate dehydrogenase E1 component subunit alpha-1, mitochondrial
  KO
K00161  pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00020  Citrate cycle (TCA cycle)
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4330673
   00020 Citrate cycle (TCA cycle)
    4330673
   00620 Pyruvate metabolism
    4330673
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     4330673
SSDB
Motif
Pfam: E1_dh TPP_enzyme_C DXP_synthase_N
Other DBs
NCBI-GeneID: 4330673
NCBI-ProteinID: XP_015626335
UniProt: Q6Z5N4
LinkDB
Position
2:complement(30918816..30922959)
AA seq 390 aa
MAAAILLRRVPPARAQATALIAARSISDSTAPLTIETSVPFTSHIVDPPSRDVTTTPAEL
LTFFRDMSVMRRMEIAADSLYKAKLIRGFCHLYDGQEAVAVGMEAAITRSDSIITAYRDH
CTYLARGGDLVSAFAELMGRQAGCSRGKGGSMHFYKKDANFYGGHGIVGAQVPLGCGLAF
AQKYRKEETATFALYGDGAANQGQLFEALNISALWKLPAILVCENNHYGMGTAEWRAAKS
PAYYKRGDYVPGLKVDGMDVLAVKQACKFAKEHAIANGPIVLEMDTYRYHGHSMSDPGST
YRTRDEISGVRQERDPIERVRKLILAHDLATAAELKDMEKEIRKEVDDAIAKAKESPMPD
TSELFTNVYVKGFGVESFGADRKELRATLP
NT seq 1173 nt   +upstreamnt  +downstreamnt
atggctgcggccatcctcctccgccgcgtcccccccgcgcgggcccaggccacggcgctc
atcgcggcgcgctcgatctcggactccacggcgccgctcaccatcgagacctcggtcccc
ttcacctcccacatcgtcgacccgccctcgcgcgacgtcaccaccaccccggccgagctc
ctcaccttcttccgcgacatgtccgtgatgcgccggatggagatcgccgcggattccctc
tataaggccaagctcatccgcgggttctgccacctctacgacggccaggaggccgtcgcc
gtcgggatggaggccgccatcacccgctccgattccatcatcaccgcgtaccgcgatcac
tgcacctacctcgcacgcggcggcgacctcgtctccgcgttcgcggagctcatgggccgc
caggctgggtgctcccgcgggaagggcggatccatgcatttctacaagaaggacgccaat
ttctatggtggccacggtatcgtcggcgcccaggttccccttggatgcggtctcgccttc
gcgcagaagtataggaaagaggaaactgctacgtttgccctctatggtgatggtgccgcg
aaccagggccagctctttgaggccctcaatatatcggctctttggaagctgccagctata
ttggtctgcgaaaacaaccattatgggatgggaaccgctgagtggagggcagcaaagagc
cctgcctactacaagcgtggtgattatgtgcctggattgaaggttgatggaatggatgtt
cttgctgtgaagcaggcatgcaaattcgcaaaagagcatgctattgcaaatggcccaatt
gttcttgaaatggatacctacaggtaccatggccattctatgtcagatcccggaagcact
taccgtaccagggatgagatctcaggtgtaagacaggagcgtgatccaattgaaagggtt
aggaagttgattttggctcatgacctagcaactgctgctgagctcaaggacatggagaaa
gaaatcagaaaagaagtcgatgatgccattgcgaaagcaaaggagagtcctatgcctgat
acttctgagctctttacgaatgtatatgtcaagggttttggtgtggagtcatttggggca
gacaggaaggaattgagagctactcttccatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333564
Entry
4333564           CDS       T01015                                 
Name
(RefSeq) pyruvate dehydrogenase E1 component subunit beta-4, chloroplastic
  KO
K00162  pyruvate dehydrogenase E1 component beta subunit [EC:1.2.4.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00020  Citrate cycle (TCA cycle)
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4333564
   00020 Citrate cycle (TCA cycle)
    4333564
   00620 Pyruvate metabolism
    4333564
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     4333564
SSDB
Motif
Pfam: Transket_pyr Transketolase_C
Other DBs
NCBI-GeneID: 4333564
NCBI-ProteinID: XP_015631374
UniProt: Q10G39
LinkDB
Position
3:24902339..24905495
AA seq 400 aa
MAAASSLHAAPRVGSSSSFSSSSSAGRRSASAARSVRVAAAAGSCAARRAGGRMVARAAV
ASKAESPASAASSKSDGHEVLLFEALREALIEEMKEDPTVCVFGEDVGHYGGSYKVTKGL
AEMFGDLRVLDTPIAENSFTGMGVGAAMKGLRPVVEGMNMGFLLLAYNQISNNCGMLHYT
SGGQFKIPIVIRGPGGVGRQLGAEHSQRLESYFQSIPGLQMVACSTPYNAKGLMKAAIRS
ENPVVLFEHVLLYNLKEKIPDEEYVLCLEEAEMVRPGEHVTILTYSRMRYHVMQAAKTLV
NKGYDPEVIDIRSLKPFDLHTIGNSIKKTHRVLIVEECMRTGGIGASLRSAIIDNFWDYL
DAPIMCLSSQDVPTPYAAPLEDATVVQPAQIVAAVEQICQ
NT seq 1203 nt   +upstreamnt  +downstreamnt
atggcggccgcttcctccctccacgccgccccgcgggtgggatcctcctcctccttctcc
tcctcctcctccgctggccgcagatcagcctccgcggcgaggagcgtgcgcgtggcggcg
gcggccggatcgtgcgcggcgcggcgggcggggggaaggatggtggcgcgggccgccgtt
gcatccaaggcggaatcgccggcgagcgcggcctcctccaagtctgacggtcatgaggtc
ttactgtttgaggctcttcgcgaggccttgatagaagagatgaaagaagatccaacggta
tgtgtctttggtgaagatgtcggtcactatggaggttcttacaaggtgaccaaaggtctg
gctgagatgtttggagacctacgagtccttgatacccctattgctgagaactcattcacc
ggcatgggagttggagcagcgatgaaggggttgaggcctgttgttgaaggaatgaacatg
ggtttccttctccttgcttacaaccaaatctcaaacaactgcggaatgcttcactacacc
tctggtggccagttcaaaatcccaatcgtgatccgaggtcctggtggagttggtcgccag
cttggtgctgagcactcccagcgtctggagtcttactttcagtcgatccccggcctccag
atggttgcttgctctaccccttacaacgccaagggtctgatgaaagccgccataaggagc
gagaaccccgtggtgctattcgagcacgtccttctgtacaacctgaaggagaaaattccc
gacgaggaatatgttctatgcctggaggaggctgagatggtgcgtcccggagaacatgtt
accatcctcacatactcgcggatgaggtaccatgtgatgcaggctgcgaagaccctggtg
aacaaagggtatgatcccgaggtcatcgacatcaggtcgttgaagccatttgacctgcac
accataggcaactctatcaagaagacccaccgcgtgctgattgtggaggagtgcatgcgc
acgggcgggatcggcgccagcttgagatcggccatcatcgacaacttctgggactacctt
gacgcacccatcatgtgcttgtcgtcgcaggatgtgccgacgccgtatgctgcgcctctg
gaggatgccaccgtcgtgcagcctgcccagattgtggctgccgttgagcaaatatgccag
taa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334968
Entry
4334968           CDS       T01015                                 
Name
(RefSeq) pyruvate dehydrogenase E1 component subunit alpha-3, chloroplastic
  KO
K00161  pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00020  Citrate cycle (TCA cycle)
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4334968
   00020 Citrate cycle (TCA cycle)
    4334968
   00620 Pyruvate metabolism
    4334968
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     4334968
SSDB
Motif
Pfam: E1_dh TPP_enzyme_C Transketolase_N DXP_synthase_N
Other DBs
NCBI-GeneID: 4334968
NCBI-ProteinID: XP_015636508
UniProt: Q7XTJ3
LinkDB
Position
4:1135884..1139712
AA seq 425 aa
MAAASSFTAAAKFLAPVSARSAGDYKPPLPLPASASLRPGRKPAPRLRTALAVSSDVLPG
NKAAPAAAAHSAVTREEALELYEDMVLGRIFEDMCAQMYYRGKMFGFVHLYNGQEAVSTG
FIKLLNQADCVVSTYRDHVHALSKGVPARSVMAELFGKATGCCRGQGGSMHMFSEPHNLL
GGFAFIGEGIPVATGAAFAAKYRHEVLKQSSPDGLDVTLAFFGDGTCNNGQFFECLNMAQ
LWKLPIVFVVENNLWAIGMSHLRATSDPEIYKKGPAFGMPGVHVDGMDVLKVREVAKEAI
ERARRGEGPTLVECETYRFRGHSLADPDELRRPDEKSHYAARDPITALKKYIIEQNLATE
SELKSIEKKIDDVVEEAVEFADASPLPPRSQLLENVFSDPKGFGIGPDGKYRCEDPLFTQ
GTAQV
NT seq 1278 nt   +upstreamnt  +downstreamnt
atggccgccgcgtcctccttcaccgccgccgccaagttcttggcgccggtgtccgcgaga
tccgccggggactacaagccgccgctcccgctcccggcctccgcctccctcaggcccggg
aggaagcccgcgccccgcctccgcaccgcgctcgccgtctcctccgacgtgctccccggg
aacaaggccgcccccgccgccgccgcccactccgctgtcacgcgggaagaggctttggag
ctgtacgaggacatggttcttggccgtattttcgaggatatgtgcgcgcaaatgtactac
cgtggcaagatgtttggttttgtccatttatacaatgggcaagaagctgtctccactggc
ttcatcaagctgctcaaccaagctgactgtgttgtcagcacataccgtgaccacgtccat
gccctatccaagggtgtccctgcacgttctgtcatggctgagcttttcggtaaggccact
ggctgctgccgtggacaaggtggttctatgcacatgttctctgaaccccacaacctcctt
ggaggttttgccttcatcggagagggcatccctgttgctactggtgctgcctttgctgct
aaataccgccatgaggtgctcaagcagtctagccctgatggacttgatgtaaccctggca
ttctttggtgatggtacctgtaacaatggccaattctttgagtgcctgaacatggctcag
ctttggaagcttcctattgtgtttgttgtggagaacaatctatgggcaattgggatgtcg
catcttagggctacttcagacccagagatttataagaagggtccagcgtttggaatgccc
ggcgtgcatgttgatgggatggatgtcctgaaggtcagggaggtggctaaggaggccatt
gagagggcaaggagaggtgaaggaccgactcttgtggagtgtgagacttaccggttcaga
gggcattctcttgctgatccagatgagctcaggagacctgatgagaaatctcattacgcc
gcaagggaccccattacagccttgaagaagtacatcatcgaacagaaccttgcaactgaa
tccgagctgaagagcatcgagaaaaagatcgatgatgttgttgaagaggccgtggagttc
gctgacgcaagcccgctccctccccggagccagcttctggaaaacgtgttctcagatccc
aagggctttggaattggccctgacgggaagtaccggtgtgaggatcccttgttcacgcaa
ggcacggcccaagtctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337862
Entry
4337862           CDS       T01015                                 
Name
(RefSeq) dihydrolipoyl dehydrogenase 1, chloroplastic
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00020  Citrate cycle (TCA cycle)
osa00260  Glycine, serine and threonine metabolism
osa00280  Valine, leucine and isoleucine degradation
osa00310  Lysine degradation
osa00380  Tryptophan metabolism
osa00620  Pyruvate metabolism
osa00630  Glyoxylate and dicarboxylate metabolism
osa00640  Propanoate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01240  Biosynthesis of cofactors
Module
osa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
osa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
osa_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
osa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
osa_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4337862
   00020 Citrate cycle (TCA cycle)
    4337862
   00620 Pyruvate metabolism
    4337862
   00630 Glyoxylate and dicarboxylate metabolism
    4337862
   00640 Propanoate metabolism
    4337862
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4337862
   00280 Valine, leucine and isoleucine degradation
    4337862
   00310 Lysine degradation
    4337862
   00380 Tryptophan metabolism
    4337862
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4337862
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     4337862
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   4337862
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox FAD_binding_2 FAD_oxidored GIDA Lys_Orn_oxgnase Thi4 Pyr_redox_3 UDPG_MGDP_dh_N DAO STALD
Other DBs
NCBI-GeneID: 4337862
NCBI-ProteinID: XP_015637430
LinkDB
Position
5:complement(3313369..3319855)
AA seq 567 aa
MNSAAAAAACASAPAWVVGGGAGGGARSARGPCGIRVCGLGGEAVALRSLRISQGAAVRR
AAVAARAAAENGVAGSGGFDYDLVIIGAGVGGHGAALHAVEEGLKTAIIEGDVVGGTCVN
RGCVPSKALLAVSGRMRELHDEHHMKSLGLQVSSPGYDRQAVADHANNLASKIRSNLTNS
MKALGVDILSGFGAIVGKQKVRYGKVGFPDKEITARNIIIATGSVPFVPKGIEVDGKTVF
TSDHALKLESVPDWIAIVGSGYIGLEFSDVYTALGSEVTFVEALDQLMPGFDPEIAKLAQ
RVLINPRNIDYHTGVFASKITPAKDGKPVQIELIDAKTKEHKETLEVDAALIATGRAPFT
KGLGLENINVVTQRGFIPVDERMRVMDADGNVVPNLYCIGDANGKLMLAHAASAQGISVV
EQISGRDHILNHLSIPAACFTHPEISMVGLTEPQAREKADKEGFEISVVKTSFKANTKAL
AENEGDGLAKLIYRPDTGEILGVHILGLHAADLIHEASNAIALGTRLQDIKFAVHAHPTL
SEVLDELFKAAKVNSGVSHSVNEPVAA
NT seq 1704 nt   +upstreamnt  +downstreamnt
atgaactccgcggcggcggcggcggcgtgcgcctcggccccggcgtgggtggtcggcggc
ggcgccggcgggggagccagatccgcgcgggggccatgcgggatcagggtgtgcgggctc
gggggcgaggcggtggcgctccgctcgctgcggatctcgcagggggcggcggtgaggcgg
gcggcggtggcggcgagggcggccgcggagaacggcgtggcggggagcggcgggttcgac
tacgacctcgtcatcatcggcgccggcgttggtgggcacggcgcggcgctccacgctgtc
gaggagggtttgaaaactgcaattattgagggagatgttgtaggtgggacttgtgtaaac
agaggttgtgtcccatcaaaagcacttcttgctgtcagcggtcgcatgagggagcttcat
gatgaacatcacatgaagtcattgggtctacaggtttcatcccctggatatgacagacaa
gctgttgctgatcatgcaaacaatctcgcctctaaaatccgaagcaacttgactaattca
atgaaagctctgggagtggatatattgagtggttttggtgcaattgttggaaaacaaaag
gtacggtatggaaaagttggttttccagacaaagaaatcactgcaaggaatatcatcatt
gctactggatcagttccttttgttcccaagggcatagaggttgatgggaaaactgttttt
accagtgatcatgcactaaaacttgagtctgtcccggactggatagcaatcgttggaagt
ggatacattgggcttgaattcagtgatgtatatacagctcttggaagtgaggttactttt
gttgaagctcttgaccagctaatgcctggttttgatcctgaaattgcaaaattagcccag
agagtccttatcaaccctcggaatatagactatcacactggtgtttttgcaagcaagatt
actccagcaaaggatggaaaacctgtgcagattgagctcattgatgcaaaaacaaaggaa
cacaaagaaaccctcgaggtggatgcagcccttatagccacaggacgggcaccattcaca
aaaggacttggcttggaaaatatcaatgttgttacacagcgtggttttattcctgttgat
gagcgaatgcgagtcatggatgcagatggcaatgtggttccgaacttatattgcattgga
gatgccaatggtaaactcatgcttgctcatgctgccagtgcacagggaatctctgttgtc
gaacaaatctctgggagggaccacatcctaaatcatttaagcatccccgctgcttgcttc
actcatccagagattagtatggttgggcttacagagccacaagccagagaaaaagctgat
aaagaaggatttgagataagtgttgttaagaccagctttaaggctaatacaaaagcattg
gcagaaaatgaaggagatggacttgctaagttgatttaccggcctgacactggagaaatt
cttggtgtgcacattttgggtttgcacgctgctgacctcatccacgaggcatcaaatgcc
attgccctaggaactcggttgcaagacatcaagtttgctgttcatgcacacccaacattg
tccgaggtgctggacgaactctttaaagcagccaaggttaattcgggtgtttctcattct
gtaaatgaaccagttgcagcctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337881
Entry
4337881           CDS       T01015                                 
Name
(RefSeq) dihydrolipoyl dehydrogenase, mitochondrial
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00020  Citrate cycle (TCA cycle)
osa00260  Glycine, serine and threonine metabolism
osa00280  Valine, leucine and isoleucine degradation
osa00310  Lysine degradation
osa00380  Tryptophan metabolism
osa00620  Pyruvate metabolism
osa00630  Glyoxylate and dicarboxylate metabolism
osa00640  Propanoate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01240  Biosynthesis of cofactors
Module
osa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
osa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
osa_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
osa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
osa_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4337881
   00020 Citrate cycle (TCA cycle)
    4337881
   00620 Pyruvate metabolism
    4337881
   00630 Glyoxylate and dicarboxylate metabolism
    4337881
   00640 Propanoate metabolism
    4337881
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4337881
   00280 Valine, leucine and isoleucine degradation
    4337881
   00310 Lysine degradation
    4337881
   00380 Tryptophan metabolism
    4337881
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4337881
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     4337881
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   4337881
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 GIDA FAD_oxidored FAD_binding_2 NAD_binding_8 AlaDh_PNT_C DAO Thi4 HI0933_like FAD_binding_3 UDPG_MGDP_dh_N 3HCDH_N Lys_Orn_oxgnase Lycopene_cycl
Other DBs
NCBI-GeneID: 4337881
NCBI-ProteinID: XP_015639335
LinkDB
Position
5:3526771..3530399
AA seq 504 aa
MAMASLARRRAAEAALLRRAPAAAWASAWRGYAAAAAGEESDVVVIGGGPGGYVAAIKAA
QLGLKTTCIEKRGTLGGTCLNVGCIPSKALLHSSHMYHEAKASFAHHGIKFSNLEIDLPA
MMSQKDKAVAGLTKGIEGLFKKNKVEYVKGFGKFVSPSEVSVDLLDGGSTTVKGKNIIIA
TGSDVKSLPGVTIDEKKIVSSTGALALSEIPKKLVVIGAGYIGLEMGSVWNRLGSEVTVV
EFASDIVPSMDGEIRKQFQRMLEKQKMKFMLKTKVVGVDTSGSGVKLTVEPAAGGEQSVL
ECDIVLVSAGRVPYTSGLGLNALGVETDKGGRILVDKRFMTNVKGVYAIGDAIPGPMLAH
KAEEDGVACVEFIAGKEGHVDYDTVPGVVYTHPEVASVGKTEEQVKASGVAYQVGKFPLL
ANSRAKAIDDAEGLVKVVAEKETDRILGVHIMAPNAGEIIHEAVLALQYGASSEDIARTC
HAHPTVSEALKEACLQTYLKAIHI
NT seq 1515 nt   +upstreamnt  +downstreamnt
atggcgatggcgagcttggcgaggaggcgcgcggcggaggcggcgctgctgcggcgggcg
ccggcggcggcgtgggcgtccgcgtggagggggtacgcggcggcggcggcgggggaggag
agcgacgtcgtggtgatcggcggcgggccgggcgggtacgtggccgccatcaaggcggcg
cagctagggctcaagaccacctgcatcgagaagaggggaacgctcgggggcacctgcctc
aacgtcggctgcatcccctccaaggctctcctgcattcgtcgcatatgtaccatgaggcc
aaggcttcttttgcacaccatggtatcaaattctcaaatcttgaaatagatttgcctgcc
atgatgtcacagaaagacaaagcagttgctgggctgactaaagggattgaaggcctgttc
aagaagaacaaggttgagtatgtcaaaggatttggaaagtttgtgtccccttcagaggta
tctgttgacttgctcgatggtggtagcactactgttaaagggaagaacataatcattgcc
actggctcagatgtgaaatcactccctggagttacaatagatgagaagaagatcgtgtca
tctactggtgctcttgctctttcagaaataccaaagaagttggtggttattggagctgga
tacattggtttagagatgggttctgtctggaacaggctagggtctgaggtcactgtcgtt
gaattcgcttctgacattgtcccgtcaatggatggagagattaggaagcagttccagcgt
atgctggagaagcagaaaatgaagttcatgcttaagacaaaagttgttggggttgatacc
tctgggagtggtgtcaagttaactgtggagcctgcagctggtggagagcagagtgttctt
gagtgtgatattgttcttgtatctgctggcagagtaccatacacctctggtcttggattg
aacgcccttggtgttgagactgacaagggtggaagaatccttgtcgacaagcgctttatg
acaaatgttaagggtgtttatgcgattggagatgcgatccctggacccatgcttgcacat
aaagctgaagaagatggtgttgcctgtgttgaattcatcgcaggtaaagaaggtcacgta
gattatgacactgtacctggagtggtgtacacacacccagaggtggcttctgttgggaag
acggaagaacaggtcaaggcatcaggagtggcctaccaggttgggaagttccccctgttg
gccaacagccgtgcaaaggcaattgatgatgctgaagggttggtcaaggtagtggctgag
aaggagaccgatagaatcctcggtgtacatataatggcccctaatgcaggtgagataatc
catgaggcggtgcttgcacttcagtatggagcatctagtgaggatattgcacggacatgc
catgcgcatccaacagtgagcgaagccctgaaggaggcttgcctacagacctacctgaag
gcgattcacatttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339859
Entry
4339859           CDS       T01015                                 
Name
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 3 of pyruvate dehydrogenase complex, mitochondrial isoform X1
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00020  Citrate cycle (TCA cycle)
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4339859
   00020 Citrate cycle (TCA cycle)
    4339859
   00620 Pyruvate metabolism
    4339859
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     4339859
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding ACT
Other DBs
NCBI-GeneID: 4339859
NCBI-ProteinID: XP_015640863
LinkDB
Position
6:complement(370057..375051)
AA seq 567 aa
MRRCPRFAHHLRLRSQLLRLRAEASSWLRRAHAILGCERGTVVRHFSSSTCSSLVKEDTV
SSSNLHPEYAKKIGGSDFSHDRQSGKELQNFKVSPQEASRASNFMRASKYGMPITANGVH
SLFSCGQVVPSRCFSSGADLPPHQEIGMPSLSPTMTEGNIARWVKKEGDKVSPGEVLCEV
ETDKATVEMECMEEGYLAKIIHGDGAKEIKVGEIIAVTVEEEEDIGKFKDYKAPSSAESA
APAESKPQSEPTEPKKEKEQPKAPEPKATKTEESFLSEDRTFSSPIARKLAEDNNVPLSS
IKGTGPDGRILKADIEDYLASVAKGAKKETAAAPGLGYVDLPNTQIRKVTANRLLHSKQT
IPHYYLTVDTRVDKLIKLRSELNPLQDTSGGKKISINDLVIKAAALALRNVPECNSSWMN
DFIRQYHNVNINVAVQTEDGLFVPVIRDADKKGLATIADEVKQLAQRARDNSLKPEDYEG
GTFTVSNLGGPFGIKQFCAIVNPPQSAILAIGSAEKRVIPGAEGQFEVGSFMSATLSCDH
RVIDGAIGAEWMKAFKGYIENPTTMLL
NT seq 1704 nt   +upstreamnt  +downstreamnt
atgcgccgatgcccccggtttgcccaccacctgcggctgcgctcgcaattgctgcgcctg
agggctgaggcttcttcttggttgcgaagagcgcatgctatcctcggatgcgagcgtggg
actgttgttcgtcacttctcatccagcacttgctcctctcttgtaaaggaagatactgta
tcaagttccaaccttcatccagagtatgcaaaaaaaattggaggatcagatttttcccat
gacaggcagtctggaaaagagcttcagaatttcaaggtctcaccgcaagaagcaagtaga
gcctccaatttcatgagagcatccaaatatggaatgccaattactgctaatggggtacat
agtttgttctcatgtgggcaggtagtaccgtctaggtgtttttcaagtggagcagatttg
cctccacatcaggaaatcggaatgccttcactctcccctaccatgactgagggaaacatt
gcaaggtgggtgaagaaagaaggagataaagtctcacctggtgaagttctttgtgaagta
gagactgataaagcgacagtggagatggaatgcatggaggaaggctaccttgctaaaatt
atccatggagatggtgccaaagaaattaaagttggtgagattattgccgtaaccgtggaa
gaagaggaagacatcggcaaatttaaggattataaggctccatcatctgctgaatctgca
gctccagccgaatcgaagccccaatctgagcccacagaaccaaaaaaggagaaagagcag
cccaaggctcctgagccaaaggctacaaagacagaagaatcttttctttcagaggatcgc
acattctccagtccaattgcaaggaaattggcagaagacaacaatgtaccactgtcaagc
ataaaaggtactggccccgatgggcgaattttgaaggcagatattgaggattacttggct
tctgtggccaagggtgccaagaaggaaacagcagcagctcctggactaggctatgtggat
cttcctaatacgcaaataaggaaggttactgcaaaccgcctgctgcactccaagcaaacc
attcctcactactatctgacagttgatactcgtgttgacaaacttattaagttgcgaagt
gagttgaatcctctgcaggatacctctggtggcaagaagatatccataaatgatcttgtt
atcaaggccgcagcattggctcttcgtaatgttcctgagtgtaatagctcttggatgaat
gattttattcgccaataccacaatgtgaacatcaatgttgctgtacaaactgaggatggc
ttgtttgttcccgtaataagggatgctgacaagaagggcctagccactatcgctgatgag
gtgaagcaactggctcagagagcaagggacaacagccttaagccagaggattatgagggt
ggcactttcactgtgtcaaacttgggaggcccttttggaattaagcaattctgtgccatc
gtaaatcctccacaatcagcaattttggctattggctcagctgagaagagggtgatccct
ggagctgagggtcagtttgaagttggttcgtttatgtcagcaacattgagctgcgaccac
cgggtcattgacggtgccattggtgcagaatggatgaaggcgttcaagggctacatcgag
aatccaacgaccatgttgctgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340640
Entry
4340640           CDS       T01015                                 
Name
(RefSeq) pyruvate dehydrogenase E1 component subunit alpha-2, mitochondrial
  KO
K00161  pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00020  Citrate cycle (TCA cycle)
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4340640
   00020 Citrate cycle (TCA cycle)
    4340640
   00620 Pyruvate metabolism
    4340640
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     4340640
SSDB
Motif
Pfam: E1_dh TPP_enzyme_C DXP_synthase_N
Other DBs
NCBI-GeneID: 4340640
NCBI-ProteinID: XP_015641790
UniProt: Q654V6
LinkDB
Position
6:7602369..7605777
AA seq 398 aa
MAAAVVLLRRLRGVTAAPRRAAAALPLTTSVRGVSDSTEPLTIETSVPYKSHIVDPPPRE
VATTARELATFFRDMSAMRRAEIAADSLYKAKLIRGFCHLYDGQEAVAVGMEAATTRADA
IITAYRDHCAYLARGGDLAALFAELMGRRGGCSRGKGGSMHLYKKDANFYGGHGIVGAQV
PLGCGLAFAQRYRKEAAVTFDLYGDGAANQGQLFEALNMAALWKLPVVLVCENNHYGMGT
AEWRASKSPAYYKRGDYVPGLKVDGMDVLAVKQACKFAKQHALENGPIILEMDTYRYHGH
SMSDPGSTYRTRDEIAGIRQERDPIERVRKLLLAHDFATTQELKDMEKEIRKQVDTAIAK
AKESPMPDPSELFTNVYVNDCGLESFGVDRKVVRTVLP
NT seq 1197 nt   +upstreamnt  +downstreamnt
atggccgcggccgtcgtcctcctccgccgcctgcgcggcgtcacggcggcgccccggcgc
gcggcggcggcgctgcccctgaccacgagcgtccggggtgtctccgattcgacggagccg
ctcaccatcgagacctcggtcccctacaagtcccacatcgtggacccgcccccgcgcgag
gtggccaccacggcgcgcgagctcgccaccttcttccgcgacatgtccgccatgcgccgc
gcggagatcgcggcggactcgctgtacaaggcgaagctgatccgcggcttctgccacctc
tacgacggacaggaggccgtcgcggtgggcatggaggcggccaccacccgcgccgacgcc
atcatcacggcctaccgcgaccactgcgcctacctcgcccgcggcggcgacctcgccgcc
ctcttcgccgagctcatgggccgccgcggcgggtgctccagggggaaaggcgggtcgatg
cacctgtacaagaaggacgccaacttctatggcggccatggcatcgtgggcgcgcaggtg
ccgctcggatgcggcctcgcgttcgcgcagaggtacaggaaggaggccgccgtcacgttc
gacctctacggcgacggcgccgccaaccaggggcagctgttcgaggcgctcaacatggcg
gcgctctggaagctgcccgtcgtgctcgtctgcgagaacaaccactatgggatggggacg
gcggaatggagggcatcgaaaagccccgcatactacaaacgcggcgactatgtgccagga
ttgaaggtcgatggtatggatgttcttgcagtcaaacaagcttgtaaatttgccaagcaa
catgctcttgaaaatggaccgattattcttgagatggacacctacagataccacggacac
tctatgtcagatccagggagcacttaccgcaccagagatgaaattgcaggcataagacag
gagcgcgatccaattgaaagggttaggaagctactactggcccatgactttgcaaccaca
caagaactcaaggacatggagaaagaaataaggaagcaagtcgacactgccatcgcgaaa
gcaaaggaaagtccaatgcccgatccatctgagctctttacaaatgtatatgttaatgac
tgcggtttggagtcatttggtgtggacaggaaggtggtgagaactgtacttccctag

DBGET integrated database retrieval system