KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326855
Entry
4326855           CDS       T01015                                 
Name
(RefSeq) ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00030  Pentose phosphate pathway
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    4326855
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     4326855
SSDB
Motif
Pfam: PfkB Phos_pyr_kin DUF6462
Other DBs
NCBI-GeneID: 4326855
NCBI-ProteinID: XP_015619662
UniProt: Q0JKL8 A0A0P0V692
LinkDB
Position
1:27185581..27191245
AA seq 367 aa
MPTLDARLRLPLAGLSPATTSFPGSTPKPGSLSFALRPPSASLSSSASAPAAAAPPIVVV
GSANADIYVEVDRLPLVGETVAARAGRSLAGGKGANQAACGGRLAAGPTYLVARVGDDAN
GRLLEGALADAGGVRLDRVARAPGAPSGHAVVMLMPGGQNSIIIVGGANMEGWASGVGSD
DLDLIRRAGVLLLQREIPDWVNVQVAQAAKGAGVPVILDAGGMDAPVPGELLSLVDIFSP
NETELARLTGMPTETFEQISRAAGACHKMGVKEVLVKLGSQGSALFIEGGEPIRQPIIPA
TEVVDTTGAGDTFTSAFAVALVEGKPKEECMRFAAAAASLCVQVKGAIPSMPDRKSVMDL
LESVQVE
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgcctactctcgacgctcgcctccgcctccctctcgccggactatcgccggcgacgacc
tccttcccgggatccacccccaagccgggcagcctctcgttcgccctcaggccgccctcc
gcctccctgtcatcctccgccagtgccccggcggcggcggcgccgcccatcgtcgtcgtg
ggctccgccaacgccgacatctacgtcgaggtcgaccgcctcccgctcgtcggggagacg
gtggcggcgcgcgccggccgcagcctcgcgggcgggaagggcgccaaccaggccgcctgc
gggggccgcctcgcggcggggcccacctacctcgtggcgcgcgtcggggacgacgccaac
gggcggctcctcgagggcgccctcgcggacgccggcggcgtccgcctagaccgcgtcgcg
cgcgcgcccggcgcgccctcgggccacgccgtggtgatgctgatgcccggcgggcagaac
tccatcatcatcgtcggcggcgccaacatggaggggtgggcctcgggggtcggctcggac
gacctggacctgatccgccgggctggcgtgctgctgctgcagcgggagatacccgattgg
gtcaacgtgcaggttgcgcaggcagcaaaaggtgcaggtgtgcctgttatcttggacgcc
ggtggaatggatgctcctgtccctggggaactactgagcctggtggatatttttagtcca
aatgaaacagagcttgcacgtttgactgggatgcctacagaaacatttgaacagatcagt
cgagctgcaggagcatgccataaaatgggtgtgaaagaagtgctggttaaactcggatca
caaggatctgctttatttattgaagggggggagccgatcaggcagccgataattcctgcc
acagaagttgttgatacgactggtgccggtgacactttcacctcagcttttgctgtagct
ctagttgagggtaaacctaaggaagagtgcatgagatttgctgctgctgctgcatctcta
tgtgttcaagtaaagggagccatacccagcatgcctgaccgaaaatcagtaatggacctt
ctggaatctgttcaggttgaataa

DBGET integrated database retrieval system