KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326865
Entry
4326865           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L18a-like
  KO
K02882  large subunit ribosomal protein L18Ae
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4326865
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4326865
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4326865
SSDB
Motif
Pfam: Ribosomal_L18A
Other DBs
NCBI-GeneID: 4326865
NCBI-ProteinID: XP_015651447
UniProt: Q0JKK9
LinkDB
Position
1:complement(27266620..27268489)
AA seq 178 aa
MVAFRFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM
LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF
PCIQIIKTATVHFKLCKRDNTKQFHNGSIKFPLVYRKVRPPTRKLKTTFKASRPNLFM
NT seq 537 nt   +upstreamnt  +downstreamnt
atggtggccttcaggttccatcagtaccaggtggtggggcgcgcgctgccgacccccggc
gatgagcaccccaagatctaccggatgaagctctgggccaccaatgaggtccgcgccaag
agcaagttctggtacttcctgaggaagctgaagaaggtgaagaagagcaacggccagatg
ctcgccatcaacgagatcttcgagcgcaacccaaccacgatcaagaactatggcatctgg
ctgcgttaccagagcagaaccggttaccacaacatgtacaaggagtaccgtgacactaca
ttgaatggtgccgtggaacagatgtacaccgagatggcttctcgccaccgtgtgagattc
ccttgcatccagatcatcaagaccgccactgtccacttcaagctctgcaagagggacaac
accaagcagttccacaacgggagcatcaagttcccccttgtgtaccgcaaggtcaggccg
ccaaccaggaagctcaagaccacgttcaaggcgtcgaggccaaacctgttcatgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327004
Entry
4327004           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L18a
  KO
K02882  large subunit ribosomal protein L18Ae
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4327004
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4327004
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4327004
SSDB
Motif
Pfam: Ribosomal_L18A
Other DBs
NCBI-GeneID: 4327004
NCBI-ProteinID: XP_015621966
UniProt: Q943F3
Structure
LinkDB
Position
1:complement(31559227..31560860)
AA seq 178 aa
MGAFRFHQYQVVGRGLPTPTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQI
LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF
PCIQIIKTATVHFKLCKRDNTKQFHKSDIKFPLVYRKVRPPTRKLKTTFKASRPNLFM
NT seq 537 nt   +upstreamnt  +downstreamnt
atgggcgccttcaggttccaccagtaccaggtggtggggaggggcctgccgacgccgacc
gacgagcaccccaagatctaccgcatgaagctctgggctaccaacgaggtccgcgccaag
tccaagttctggtacttcctccgcaagctgaagaaggtgaagaagagcaacgggcagatc
cttgccatcaacgagatttttgagaagaacccaacaactatcaagaactatggcatctgg
ctgcgttaccagagtaggactggctaccacaacatgtacaaggagtaccgtgataccacc
ctcaatggtgccgttgagcagatgtacactgagatggcttcccgccaccgtgtcagattc
ccttgcattcagatcatcaagactgctactgtccactttaaactctgcaagcgtgacaac
actaagcagttccacaagtcagatatcaagttcccactggtgtacaggaaggtcaggccc
cctaccaggaagctgaagacaaccttcaaagcttcaaggccaaacttgtttatgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339625
Entry
4339625           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L18a-like
  KO
K02882  large subunit ribosomal protein L18Ae
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4339625
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4339625
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4339625
SSDB
Motif
Pfam: Ribosomal_L18A
Other DBs
NCBI-GeneID: 4339625
NCBI-ProteinID: XP_015639994
UniProt: Q6AUF5 B9FI54
LinkDB
Position
5:28118250..28120444
AA seq 178 aa
MVAYRFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM
LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF
PCIQIIKTATVHFKLCKRDNTKQFHNSNIKFPLVYRKVRPPTRKLKTTFKASRPNLFM
NT seq 537 nt   +upstreamnt  +downstreamnt
atggtcgcctacaggttccatcagtaccaggtggtgggtcgcgcgctcccgacccccggc
gatgagcaccccaagatctaccgcatgaagctctgggccaccaacgaggtccgcgccaag
tccaagttctggtacttcctgaggaagctgaagaaggtgaagaagagcaatggacagatg
ctcgccatcaacgagatctttgagcgtaaccctacaacgatcaagaactacggcatctgg
ctgcgttaccagagcagaacaggttaccacaacatgtacaaggaataccgtgacactact
ctgaatggtgctgtggagcagatgtacaccgagatggcctctcgtcaccgtgtgaggttc
ccctgcattcagatcatcaagaccgcaacagttcacttcaagctctgcaagagggacaac
actaagcagttccacaactcgaatatcaagttcccgctcgtgtaccgcaaggtcaggccg
cccaccaggaagctgaagaccaccttcaaggcatctaggccgaacttgttcatgtga

DBGET integrated database retrieval system