KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326889
Entry
4326889           CDS       T01015                                 
Name
(RefSeq) chorismate mutase 3, chloroplastic
  KO
K01850  chorismate mutase [EC:5.4.99.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00040  Tyrosine biosynthesis, chorismate => arogenate => tyrosine
osa_M00910  Phenylalanine biosynthesis, chorismate => arogenate => phenylalanine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    4326889
Enzymes [BR:osa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.5  chorismate mutase
     4326889
SSDB
Other DBs
NCBI-GeneID: 4326889
NCBI-ProteinID: XP_015621134
UniProt: Q5JN19 A2ZY47
LinkDB
Position
1:complement(32171767..32175017)
AA seq 313 aa
MEFNKVVSSYRAASPAPVGMARGGGGPASRVEFVPSSRRARLAATNNSVTPVTKEEKQRI
DQSEILTLDNIRTSLVRQEDSIIFSLLERAQFCYNADIYDKNAFHVDGFDGSLVEFMVRE
TEKLHQQVGRYKSPDEHPFFPEDLPEPLLPPLQYPKVLHPIADSININKEIWKMYFDELL
PRLVKEGSDGNYGSSALCDTICLQALSKRIHYGKFVAEAKFQESPEAYMPAIIAQDCDQL
MHLLTYETVERAIEHRVEAKAKIFGQEVDLGAEDNGAPPMYKIRPSLVAELYSYRIMPLT
KEVQVAYLLRRLD
NT seq 942 nt   +upstreamnt  +downstreamnt
atggagttcaacaaggtggtctccagctacagggccgcctcgcccgcgcccgtggggatg
gcccgcgggggaggagggccggccagccgcgtggagttcgtcccgtcgtcgcggcgggcg
cggctcgcggccaccaacaactccgtcacccccgtgaccaaggaggagaaacagaggata
gatcaaagtgaaatactgaccttggacaacattagaacctccttggttaggcaagaagac
agcatcatattcagcctcttagagagagcacagttttgctacaatgctgatatatatgat
aaaaatgctttccatgtggatggatttgatggctctttggttgaattcatggttagagaa
accgaaaaactacatcaacaggttgggagatacaagagccctgatgagcacccattcttt
ccggaggatctgcctgaaccactgttgccacctctccagtatccaaaggttttgcatcct
attgctgattctattaatatcaacaaggagatttggaaaatgtattttgatgagcttctt
ccaagattagtgaaagaaggaagtgatggtaattatggatccagtgctctttgtgacacg
atctgcttgcaggcgctctccaaaagaattcactatggtaagtttgtggcagaggctaag
tttcaagagtctcctgaagcttacatgcctgcgataatagcacaggactgcgatcaacta
atgcacctcctcacctatgaaacggtggagcgtgctattgaacatagggtggaagctaag
gctaagatctttggacaggaggtggatttaggcgctgaagacaacggcgctccaccaatg
tacaagataaggcccagtttggtggctgaactgtacagctacaggatcatgccgctaacc
aaggaggttcaagtagcctacttgctgaggagattggattga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328508
Entry
4328508           CDS       T01015                                 
Name
(RefSeq) chorismate mutase 2
  KO
K01850  chorismate mutase [EC:5.4.99.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00040  Tyrosine biosynthesis, chorismate => arogenate => tyrosine
osa_M00910  Phenylalanine biosynthesis, chorismate => arogenate => phenylalanine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    4328508
Enzymes [BR:osa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.5  chorismate mutase
     4328508
SSDB
Other DBs
NCBI-GeneID: 4328508
NCBI-ProteinID: XP_015623634
UniProt: A3A3T3 Q6H819
LinkDB
Position
2:complement(4486476..4489438)
AA seq 255 aa
MGEAELSLAAVRDALVREEDSIVFALIERARRPRNAPAYAAAAAAGGRSLAEFFVREAEV
LHAKAGQYQKPEDVPFFPQDLPSPLFPTKDYPKVLHSFASSVSVNDAIWKMYFNELLPLF
TVDGDDGNYAETVALDFACLKALSRRIHIGKYVAEVKFKDASQDYSPLIRAKDTKALMNL
LTFKAVEEKVKRRVEKKARIFGQNVTLEDNADKQEGNAGDSECKVNPEVLSKLYDLWVMP
LTKDVEVEYLLRRLD
NT seq 768 nt   +upstreamnt  +downstreamnt
atgggcgaggcggagctgagcctggcggcggtgcgcgacgcgctggtgcgggaggaggac
tccatcgtcttcgccctcatcgagcgcgccaggcgcccgcgcaacgcgccggcatacgcg
gccgccgccgccgccggcggccgatccctcgccgagttcttcgtccgggaagccgaggtt
ctgcacgccaaggccggacaataccaaaagccagaagatgttccattctttccccaagat
ctcccttcacctctatttcctaccaaagattacccaaaggttttgcactcttttgcatca
tcagtcagtgtgaatgatgcaatatggaagatgtatttcaacgagttgcttccactattc
actgtggatggagatgatggtaactatgcagaaacagttgcattagattttgcatgtctg
aaggccctgtcaagaagaattcatattggtaaatatgttgctgaggtgaagttcaaagat
gcttcccaagattatagtccactaatccgtgcaaaggataccaaggctctgatgaatctg
ctaacattcaaggcggttgaagagaaggtgaaaaggagagtagagaagaaggccaggata
tttggtcagaatgtcactttggaggacaatgctgacaagcaagaaggcaatgcaggtgac
agtgagtgcaaagttaatcctgaagtgctatctaagctatatgatctgtgggtaatgcct
ttgacgaaggatgttgaagttgagtatcttctccgccgtcttgactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345690
Entry
4345690           CDS       T01015                                 
Name
(RefSeq) chorismate mutase 2
  KO
K01850  chorismate mutase [EC:5.4.99.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00040  Tyrosine biosynthesis, chorismate => arogenate => tyrosine
osa_M00910  Phenylalanine biosynthesis, chorismate => arogenate => phenylalanine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    4345690
Enzymes [BR:osa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.5  chorismate mutase
     4345690
SSDB
Other DBs
NCBI-GeneID: 4345690
NCBI-ProteinID: XP_015649134
UniProt: A0A0P0XGI4 Q6Z9E6
LinkDB
Position
8:21523480..21525764
AA seq 284 aa
MAAAMILSCRYLLICSATLALLLLRLCSGLSLDTVREFLTREEDTVVFGLIERAKHPRNT
PAYDPGYLAGGGHGHDASFAEMFVRESEAVQAKAGRYQSLQEIPFFPFRVPFTLAPPYNF
TTELYSAAALVNVNDAIWSMYFNELLPLLAKNGDDGNYAATVSSDLVCLQALSRRINYGR
YVAEVKFIGDQQNYTTLIRNKDTDALMKLLTSEAQEDVVKRRVQKKAMVFGQNVTLDGPV
ETGNSNSSQTSFKVDPSLVYKLYDKWVIPLTKQVEVEYLLHRLD
NT seq 855 nt   +upstreamnt  +downstreamnt
atggcggcggcgatgattctctcctgcaggtatctgctcatctgcagcgcgacgcttgcg
ctgctgctgctgcgactgtgcagcgggctgagcctggacacggtgagggagttcctcacg
agggaggaggacaccgtcgtgttcggcctcatcgagcgggccaagcacccgcgcaacacg
ccggcctacgaccccggctacctcgccggcggcggccatggccacgacgcctctttcgcc
gagatgttcgtgcgcgagtccgaggcggttcaggccaaggcaggaaggtaccaaagcctg
caggagattcctttcttccctttcagagtgcctttcacattggcacctccatataacttc
acaaccgagctgtattctgcagccgcattagttaatgtgaatgatgccatatggagcatg
tatttcaatgagttgctccctctcctggccaagaatggcgatgatggcaactatgctgca
actgtttcatcagatcttgtatgtctgcaggcactctcaagaaggatcaactatgggagg
tatgtggcagaagtgaagttcataggcgaccagcagaactacacaactttaattcgtaac
aaggacacggatgccctgatgaaattgttgacatctgaagcccaggaagatgtggtgaag
agaagggttcagaagaaggccatggtgttcggtcaaaatgtgacattggatggaccagtt
gaaactggcaacagcaacagtagccaaacaagtttcaaagttgatccttcattagtgtat
aaactgtatgacaaatgggtgattccattgactaaacaagtggaggtcgagtacctgctc
catcgtcttgattga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352624
Entry
4352624           CDS       T01015                                 
Name
(RefSeq) chorismate mutase 1, chloroplastic
  KO
K01850  chorismate mutase [EC:5.4.99.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00040  Tyrosine biosynthesis, chorismate => arogenate => tyrosine
osa_M00910  Phenylalanine biosynthesis, chorismate => arogenate => phenylalanine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    4352624
Enzymes [BR:osa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.5  chorismate mutase
     4352624
SSDB
Other DBs
NCBI-GeneID: 4352624
NCBI-ProteinID: XP_015619178
LinkDB
Position
12:23918876..23923384
AA seq 358 aa
MAATSQAHRHHSIAIFFHLQPPPPPPMELPLDKAAARSTPLALPAAGAAAAANQSPASLP
LGPPAAASAKPLVAAANPPLLPVVAPAAAAPKSSSGAVEESKEGVEESNKSNVLTIGSIR
STLMKHEDTIIFGLLERSQFCYNPDTYDPNASRIVRFNGSLVEFMVKKTEKMHARMGRYK
SPDEHPFFPENLLEVVEPSVEYENVLHPAAANININKRIWDVYFGDLLPRLVKEGSDGNC
GSSACWDMLILQALSKRIHYGKYVAEAKFQGAPDTYTPAILNKDSDKLMELLTFAKVEDD
VRARVMSKAMTFGQVVSEDLENEIKLKIEPELAVELYDKWIMPLTKEVQVQYLLKRLD
NT seq 1077 nt   +upstreamnt  +downstreamnt
atggcggccacaagccaagctcaccgccaccactccattgccatcttcttccacctccag
cctcctcctccgcctccaatggagcttcccctggacaaggccgcggcccgctccacccca
ctcgcgctccccgccgctggggcggcggcggcggcgaaccagtccccggcgtctctgcca
ctgggaccacccgcggccgcctccgccaagcccctcgtcgcggccgccaacccgccgctg
ctgccggtggtggctccggcggcggcggcgcccaagtcgtcgtcaggggccgtggaagag
agcaaagagggtgtggaagagagcaacaagagcaatgtgttgaccattggcagcatcagg
agcacgctgatgaagcatgaggacaccatcatcttcggccttctggagaggtcacagttc
tgctacaacccggacacctacgaccccaacgcttccaggatcgtccggttcaatggctcc
ctggtcgagttcatggttaaaaagaccgagaagatgcatgctagaatggggaggtacaag
agcccggatgagcatcctttcttccctgagaatttgctggaggtggtggagccatctgtt
gagtatgagaatgttctgcatccagctgctgctaacatcaacataaacaaaaggatctgg
gatgtgtactttggtgaccttctgccaaggcttgtgaaggaaggaagtgacggtaactgt
ggatcgagcgcatgctgggacatgttaattctgcaggcactctccaagaggattcactat
ggcaagtatgtggcagaggctaagttccagggggcacctgacacgtacacgcctgcaatc
ttaaacaaggacagtgacaagctgatggaattgctgacgttcgcgaaggtggaggatgac
gtgagggcccgcgtgatgagcaaggccatgaccttcggccaggtggtgagtgaagatctg
gagaacgaaattaagctcaagatcgagccggagctggccgtggagctgtatgacaagtgg
atcatgccactgaccaaggaagtgcaagtgcagtacctcctcaagaggctggattga

DBGET integrated database retrieval system