KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326964
Entry
4326964           CDS       T01015                                 
Name
(RefSeq) long chain base biosynthesis protein 2b
  KO
K00654  serine palmitoyltransferase [EC:2.3.1.50]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00600  Sphingolipid metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    4326964
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4326964
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.50  serine C-palmitoyltransferase
     4326964
Amino acid related enzymes [BR:osa01007]
 Aminotransferase (transaminase)
  Class II
   4326964
SSDB
Motif
Pfam: Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 Beta_elim_lyase OKR_DC_1
Other DBs
NCBI-GeneID: 4326964
NCBI-ProteinID: XP_015613372
UniProt: Q8RYL1
LinkDB
Position
1:complement(40759359..40764075)
AA seq 499 aa
MVIKVPYVTAATTLFSFGLIFGFGHLRDSFRALLRLLFSSAAAADSPAGCNSKGYAPICV
GKEDFYIRRFFRRVQDCFGRPIASKPDAWFDVVERYSTDSNKTLHCTTKTSKCLNLASFN
YLGFAAADEYCTPRVIESLKKYSASTCSSRVDGGNTQLHIELEELVARFVRKPSAILLAM
GYATNSAIIPALIGKGGLIISDSLNHNSIVSGARASGATIRVFEHNNPAHLEKLLREQIS
GGQPRTHRAWKKILVIVEGIYSMEGELCKLPEIISVCKKYKVYTYMDEAHSIGAVGKTGR
GVCELLGVDPADVDIMMGTLSKSFGSSGGYIAASKEIIQHLKLTCPSHIYGTSMSPPAVQ
QVISAMKVILGEDGTDRGAKKIAQIRDNSNFFRSELQKMGFEVLGDNDSPVMPFMVYNPA
KMPAFSRECLKQNVAVVPVGFPATPLLLGRIRICISASHSREDLIKGLEVISNVGDLVGI
KYLPVEQEETTSVEKPKKL
NT seq 1500 nt   +upstreamnt  +downstreamnt
atggtgatcaaggtgccgtacgtgacggcggcgacgacgctgttcagcttcggcctcatc
ttcggcttcggccacctccgcgactccttccgcgcccttctccgcctcctcttctcctcc
gccgccgccgccgactcgccggccggctgcaactccaaaggttacgcgccgatttgcgtt
gggaaggaggatttctacatccgccgcttcttccgccgcgtccaggactgtttcgggcga
ccgatagccagcaagcctgatgcgtggttcgatgtggttgagcgctactcgactgacagc
aacaagacactgcactgcaccacgaaaacatccaagtgcctgaacctggcatccttcaac
tacctaggtttcgctgctgctgatgagtactgcacacctcgtgtcatcgagtctctgaag
aaatactctgctagtacctgcagttcccgagtcgatggaggcaacactcagctgcacata
gaactcgaagagctggttgcaagattcgtcaggaagccttcggctattctgcttgccatg
ggttatgccaccaactctgccatcattcctgccttgattgggaagggtggactgataatc
agtgattcactgaaccataactctatagtcagtggagctagagcttcaggagctacgatt
cgggtgttcgaacacaacaatcctgctcacctggaaaaactactgagagagcagatttca
ggtggacagcctagaacacacagggcatggaagaagatcctggtgattgttgaggggata
tatagcatggaaggggagctatgcaaactccctgagatcatatctgtctgcaagaagtac
aaggtttacacatacatggacgaggcacacagtattggagctgttgggaaaacaggaaga
ggtgtgtgtgagctactaggagtggatccggctgatgttgacatcatgatgggcacactc
tcaaagtcatttggatcgagtggaggttacattgcagcatcaaaagagattattcagcat
ctcaagcttacatgtccttcacatatctatggcacatccatgtcacctcctgcagtccag
caggtcatctctgcaatgaaggttattcttggggaggatggaactgacagaggggccaag
aagattgctcagattagagataacagcaatttcttccgttcagagcttcagaaaatgggc
tttgaggttcttggagataatgactcacctgtcatgcctttcatggtctacaatcctgct
aaaatgcctgcattctcaagagagtgcctgaagcaaaatgttgctgttgttccggttgga
tttcctgctacaccactacttcttggcagaattaggatatgcatttctgcttctcactca
agggaagatcttatcaaaggattggaggttatcagcaacgttggtgatcttgttggaatc
aagtacttaccagttgagcaagaggagactacatctgttgagaaaccaaagaagctttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326965
Entry
4326965           CDS       T01015                                 
Name
(RefSeq) long chain base biosynthesis protein 2c
  KO
K00654  serine palmitoyltransferase [EC:2.3.1.50]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00600  Sphingolipid metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    4326965
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4326965
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.50  serine C-palmitoyltransferase
     4326965
Amino acid related enzymes [BR:osa01007]
 Aminotransferase (transaminase)
  Class II
   4326965
SSDB
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Beta_elim_lyase Aminotran_5 SHMT
Other DBs
NCBI-GeneID: 4326965
NCBI-ProteinID: XP_015613384
UniProt: Q8RYL0
LinkDB
Position
1:complement(40766918..40771855)
AA seq 497 aa
MVRVPFVTAVTTVFSYGVIFGFGHLRDWFRALLRSLFSGHSPAAAGTNLKGYAPICGGQE
DFYYRRFVRRVQDCFWRPIASKPDAWFDVVERYSNDSNKTLHRTTKTSRCLNLGSYNYLG
FAAADEYCTPRVIESLKKYSASTCSVRVDGGNTKLHVELEELVARFVGKPAAILFGMGYV
TNSAIIPALIGKGGLIISDSLNHNSIVNGARGSGASVQVFQHNNPAHLEEVLREQIAGGQ
PRTHRRWKKIIVIVEGIYSMEGELCKLPEIVAVCKKYKAYTYLDEAHSIGAVGKTGRGVC
ELLGVDPADVDIMMGTFTKSFGSCGGYIAASKEIIDHLKHICPAHIYATSMSPPAVQQVI
SAIEVILGEDGSDRGAKKLAQIRENSNFFRSELEKMGFEVLGDNDSPVMPIMLYNPAKMP
AFSRECLRQKVAIVTVSFPATPLLLARARICISASHSREDLIKGLEVISKVGDLVGIKYL
PVEHEKTTSAEKLKKIQ
NT seq 1494 nt   +upstreamnt  +downstreamnt
atggtgagggtgccgttcgtgaccgcggtcaccacggtgttcagctacggcgtcatcttc
ggcttcggccacctccgcgattggttccgcgccctcctccgctccctcttctccggccac
tcgccggcggcagccggtaccaacctcaagggttacgcgccaatttgcggaggacaggag
gatttctattaccgacgattcgttcgtcgcgttcaggactgcttttggcgaccaatagcc
agcaagccggacgcatggttcgatgtggttgagcgctactcaaatgacagcaacaagaca
ctccaccgtaccacaaaaacatccaggtgccttaacttaggttcctacaattaccttggc
tttgctgcggcagatgaatactgcactcctcgtgttattgagtcactaaagaaatactct
gctagtacttgcagtgtccgagtcgatggaggcaacactaagctgcatgtggaacttgaa
gaactggttgcaagatttgttggcaagcctgcagctattctcttcggcatgggttatgtg
acgaactctgcgatcattcctgccttgattgggaagggaggcctcataatcagtgattca
ctgaaccataattctatagtgaatggagcaaggggttcaggagctagtgttcaagttttc
caacataacaatcctgcacacttggaagaggtattgagagagcagattgcaggaggccag
cctcgcacacaccggcgatggaagaagattattgtgattgttgagggaatatatagcatg
gaaggggagctatgcaaactccctgagattgtagctgtctgcaagaaatataaggcttac
acatatttagatgaggcacacagcattggggctgttggtaagacagggagaggtgtttgt
gaattacttggagtggacccagcggatgttgatattatgatgggaacatttactaaatca
tttggatcttgtggaggttacattgcagcatcaaaagagattattgatcatctgaagcac
atatgccctgcccatatctatgcaacatccatgtcacctcccgctgtccagcaggtcatc
tctgcaatagaagtaatccttggtgaagatggatctgacagaggagccaagaagcttgct
cagattcgggagaacagcaatttcttccgttcagaacttgagaaaatgggttttgaagtt
cttggagacaacgactcgcctgtcatgcctatcatgctttacaatcctgctaaaatgcct
gcattctcaagagagtgcctgaggcaaaaggttgccattgttactgtttcatttccggca
acgccactgctacttgccagagctaggatatgcatatcagcttcccactctagggaagat
cttattaaaggattggaggttatcagcaaagttggtgacctcgtgggaatcaaatattta
ccagtggagcatgaaaagactacatctgctgagaaactgaagaagattcagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326966
Entry
4326966           CDS       T01015                                 
Name
(RefSeq) long chain base biosynthesis protein 2d
  KO
K00654  serine palmitoyltransferase [EC:2.3.1.50]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00600  Sphingolipid metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    4326966
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4326966
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.50  serine C-palmitoyltransferase
     4326966
Amino acid related enzymes [BR:osa01007]
 Aminotransferase (transaminase)
  Class II
   4326966
SSDB
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase DegT_DnrJ_EryC1 Aminotran_5 SHMT
Other DBs
NCBI-GeneID: 4326966
NCBI-ProteinID: XP_015613397
UniProt: Q5JK39
LinkDB
Position
1:complement(40774500..40778599)
AA seq 489 aa
MVRLPYVTALTTLFSYGLLFAFGQLRDFFRRILDAGKSSNLKGYAPICLGLEDFYTRRLY
LRIQDCFGRPIASAPDAWFDVVERYSNDSNKTLHRTTKTSKCLNLGSYNYLGFAAADEYC
TPRVIESLKKYSASTCSVRVDGGNTKLHVELEELVARFVGKPAAILFGMGYVTNSAIIPA
LVGKGGLIISDSLNHNSIVNGARGSGATVRVFQHNNPAHLEEVLREQIAGGQPRTHRPWK
KIIVIVEGIYSMEGELCKLPEVIAVCKKYKAYTYLDEAHSIGAVGKTGRGVCELLGVDPA
DVDIMMGTFTKSFGSCGGYIAASKEIIDHLKHICPAHIYATSMSPPAVQQVISAIKVILG
EDGSNRGAKKLAQIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLR
QHVAVVTVAFPATPLLLARARICISASHSREDLIKGLEVISKVGDLVGIKYFPVEHEKTA
SVEKLKKLQ
NT seq 1470 nt   +upstreamnt  +downstreamnt
atggtgaggctgccctacgtgaccgcgctgaccacgctcttcagctacggcctcctcttc
gccttcggccagctccgcgacttcttccgcaggatcctcgacgctggcaaatccagcaat
ctcaagggctacgcgccgatttgccttgggctggaggatttctacacgcgccgcctctat
ctccgcatccaggactgttttggccggccaattgctagcgcaccagatgcttggtttgac
gtggttgagcgttactcaaatgacagtaacaagacactgcatcgtaccacaaaaacatct
aagtgccttaacttaggttcctacaactaccttggctttgccgcggcagatgaatactgc
acccctcgtgttattgagtcactgaagaaatactctgctagtacttgcagtgtccgagtc
gatgggggcaacactaagctgcatgtggaacttgaagagctggttgcaagatttgttggc
aagcctgcagctattctttttggcatgggttatgtgacgaactctgcaatcattcctgcc
ttggttgggaagggaggactcataattagtgactcattgaaccataactctatagtgaat
ggggctaggggttcaggagctactgttcgggtttttcaacataacaatcctgcacacttg
gaagaggtattgagagagcagattgcaggaggccagcctcgtacacacaggccgtggaag
aagattattgtgattgttgagggaatatatagcatggagggggagctatgcaaactccct
gaggttatagctgtctgcaagaaatataaggcttacacatatttagacgaggcacacagt
attggagctgttggtaaaaccgggagaggtgtttgtgagctactaggtgtggatccagct
gatgtcgatattatgatgggaacatttactaaatcatttggatcatgcggaggttacatt
gcagcatcaaaagagattattgatcatctgaagcacatatgccctgcccatatctatgca
acatccatgtcacctccagctgttcagcaggtcatttctgcaataaaagttatccttggt
gaagatggatctaacagaggggccaagaagcttgctcagattcgagagaacagcaatttc
ttccgttcagagcttcagaaaatgggttttgaagttcttggagacaatgactcgccggtc
atgcctatcatgctttacaatcctgctaaaatacctgcgttctcaagagagtgcctgagg
caacacgttgctgttgttactgttgcatttcctgctacaccactactgcttgccagagct
aggatatgtatctcagcttcccactcaagggaagatcttattaaaggattggaggttatc
agcaaagttggtgacctcgtgggaatcaaatacttcccagtggaacatgaaaagactgca
tctgttgagaaactgaagaagcttcaatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331075
Entry
4331075           CDS       T01015                                 
Name
(RefSeq) long chain base biosynthesis protein 1b
  KO
K00654  serine palmitoyltransferase [EC:2.3.1.50]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00600  Sphingolipid metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    4331075
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4331075
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.50  serine C-palmitoyltransferase
     4331075
Amino acid related enzymes [BR:osa01007]
 Aminotransferase (transaminase)
  Class II
   4331075
SSDB
Motif
Pfam: Aminotran_1_2 OKR_DC_1 Cys_Met_Meta_PP AF2212-like
Other DBs
NCBI-GeneID: 4331075
NCBI-ProteinID: XP_015622652
UniProt: Q6K8E7
LinkDB
Position
2:34463014..34467108
AA seq 481 aa
MEMVLPVANATAAALARVSAMFNAPLARAVVFGIHIDGHLVVEGLLIAAILFQLSRKSYK
PPKKPLTEREVDELCDEWQPEPLCPPIKEGARIEAPTLESAAGPHTIVDGKEVVNFASAN
YLGLIGNEKILDSCIGSVEKYGVGSCGPRGFYGTIDVHLDCETKIAKFLGTQDSILYSYG
ISTIFSVIPAFCKKGDIIVADEGVHWAVQNGLQLSRSTVVYFKHNDMASLASTLEKLTHG
NKRTEKIRRYIVVEAIYQNSGQIAPLDEIVRLKEKYRFRVILEESHSFGVLGKSGRGLAE
HYGVPIEKIDIITAGMGNALATDGGFCTGSIRVVDHQRLSSSGYVFSASLPPYLASAAIS
AVDHLEENPSVLANLRSNITLLHKELSDVQGLEIASNILSPIVFLKLKTSTGSAVADLEL
LEVISEKVLKEDSVFIAATKRSSLDKCRLPVGIRLFVSAGHTESDILKVSESLKRVAASV
L
NT seq 1446 nt   +upstreamnt  +downstreamnt
atggagatggtgttgccagtcgcgaacgcgactgctgcagcacttgcgcgggtttctgct
atgttcaatgccccgcttgctcgtgctgttgtctttgggattcatatcgatgggcacttg
gtcgtcgaagggcttctcattgccgcaatactcttccagctctccaggaagagctacaag
cctccaaagaagccactcactgagagggaggttgatgagctctgtgatgagtggcaacca
gagcctctctgcccacccatcaaggagggagctcggattgaggctcctacattagaaagt
gctgctggaccgcatacaattgttgatggaaaagaagttgtaaactttgcgtcagcaaac
taccttggtttgattggcaatgaaaagatactcgattcctgtattggttcggtggagaaa
tatggcgttggatcatgcggacctcgtggcttttatggaacgattgatgttcaccttgac
tgtgagactaaaattgcaaagttcctgggaacgcaagattcaatcttgtactcctatggg
atatcaaccatcttcagtgtgattcctgccttttgtaagaaaggagatataattgtagct
gatgagggtgttcattgggcagtacaaaatggtttgcagctttcaagaagcactgttgtt
tatttcaagcacaatgacatggcttcacttgcgagcactctggaaaaactaactcatgga
aacaaacgtacagaaaagattaggcgctatattgttgtggaagctatttaccagaattct
ggccaaattgcacccttggatgagatagttcgattgaaggagaaataccggtttcgtgtt
attttggaggagagtcattcttttggcgttcttggcaagtctggacgtggccttgctgaa
cattatggagttcctattgaaaaaatagacattatcactgctggaatgggaaatgcatta
gctactgatggtggtttctgtacaggaagtatcagagtggttgatcatcagcgtctaagc
agctccggttatgttttctctgcctcgttaccaccatatcttgctagtgcagcaatttct
gctgtggaccacctggaggagaacccatcggttcttgccaatctaagatcaaacatcact
cttctgcataaagagttgtcagatgtacaggggcttgaaattgctagtaatatattgtca
cctattgtcttcctcaaattgaagacatcaacaggttctgctgttgctgacctggagctc
cttgaggttatttcagagaaggtattgaaggaagattcagtcttcattgcagcgacgaaa
cgatcgagtttggacaagtgtcgtcttccggttggaatccgcctattcgtatcagctggt
cacactgaatctgatatcctcaaagtatctgaatccctgaaaagggttgcagcatcagtg
ctctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332274
Entry
4332274           CDS       T01015                                 
Name
(RefSeq) long chain base biosynthesis protein 1a
  KO
K00654  serine palmitoyltransferase [EC:2.3.1.50]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00600  Sphingolipid metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    4332274
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4332274
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.50  serine C-palmitoyltransferase
     4332274
Amino acid related enzymes [BR:osa01007]
 Aminotransferase (transaminase)
  Class II
   4332274
SSDB
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP OKR_DC_1
Other DBs
NCBI-GeneID: 4332274
NCBI-ProteinID: XP_015633205
UniProt: Q10P01
LinkDB
Position
3:complement(8047355..8052553)
AA seq 495 aa
MDMALPIVNATAAVLARVSAAFNAPFARAVVFGVHIDGHLVVEGLLIAVIVFQLSRKSYK
PPKKPLSEKEIDELCDEWEPEPLCPPIKDGARIDTPMLESAAAPHTTIDGKEVINFASAN
YLGLIGNEKIIDSCVGSLEKYGVGSCGPRGFYGTIDVHLDCEAKIAKFLGTPDSILYSYG
ISTIFSVIPAFCKKGDIIVADEGVHWAVQNGLHLSRSTVVYFKHNDMASLANTLEKLTRG
NKRAEKIRRYIVVESIYQNSGQIAPLDEIVRLKEKYRFRVILEESHSFGVLGQSGRGLAE
HYGVPIDKIDIITAGMGNALATDGGFCTGSVRVVDHQRLSSSGYVFSASLPPYLASAAVS
AVSYLEGNPSVLADLRSNISFLHKELSGTPGLEISSHVLSPIVFLKLKKSTGSSNTDIDL
LETIAERVLKEDSVFIVASKRSPLDRCKLPVGIRLFMSAGHTDSDISKVSSSLKRVSASV
PMIPVAAHTCKHFEK
NT seq 1488 nt   +upstreamnt  +downstreamnt
atggacatggcattgccaatagtgaatgccaccgcagcggtgcttgctcgtgtctcagct
gcattcaatgccccttttgcccgcgcagttgtctttggggttcatatcgatgggcacctg
gttgttgaagggctccttatagcggtcatagtgtttcagctttctaggaagagctacaaa
ccgcccaagaagccactcagtgaaaaggagattgacgagctatgtgatgaatgggagcca
gaacctctgtgtcctccgatcaaggatggggcccgaattgacacaccaatgttggaaagt
gctgctgctccacatacaaccattgatgggaaagaagttataaactttgcatcagcaaat
tatcttggtttgattggcaatgagaagattattgattcttgtgttggttcactggagaaa
tatggtgttggttcttgtggtccacgtggcttttatggaacaattgatgtccaccttgac
tgtgaggcaaaaatagcgaagtttcttggaactccagactcaattctgtattcatatggg
atttctacaatatttagtgtgatacctgccttttgtaagaaaggagacatcatagttgct
gatgaaggtgtgcactgggcagtgcaaaatggtcttcatctgtcaagaagcactgttgtt
tattttaaacacaatgatatggcttcacttgcaaacactttggaaaaacttacacgtgga
aataaacgagcagaaaagatcagacgatacattgttgtagaatctatctaccagaattct
ggtcaaattgctcccttggatgagattgtcagattgaaggagaaatatcgattccgtgtt
attctggaggaaagccattcttttggtgtgcttggccagtctggacgaggccttgctgaa
cattatggagttccaattgacaaaattgatattatcactgctggaatggggaatgcatta
gctactgatggtggcttttgtacaggaagtgttagagttgttgatcatcagcgtctaagc
agttctggctatgttttctcggcttctctgccaccttatcttgccagcgctgcggtttct
gctgtcagctacctggaggggaacccgtcagttcttgcagacctgaggagcaacatttct
ttcctgcataaagaactgtcaggtactccaggacttgaaatttccagccatgttctgtca
cctatcgttttcctcaaactgaagaaatcgacgggttcatcaaacaccgatatagatctt
cttgaaactattgctgagagggtattgaaggaagattcagtttttatcgtggcgtcaaag
cggtcacctttggataggtgcaaacttcccgtcggaatacgcctcttcatgtcagccggc
cacaccgattcagacatctccaaagtgtcctcatccttgaagcgggtctcagcatcagtt
ccgatgattcccgttgccgctcatacttgcaaacacttcgaaaaatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348231
Entry
4348231           CDS       T01015                                 
Name
(RefSeq) long chain base biosynthesis protein 1c
  KO
K00654  serine palmitoyltransferase [EC:2.3.1.50]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00600  Sphingolipid metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    4348231
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4348231
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.50  serine C-palmitoyltransferase
     4348231
Amino acid related enzymes [BR:osa01007]
 Aminotransferase (transaminase)
  Class II
   4348231
SSDB
Motif
Pfam: Aminotran_1_2 OKR_DC_1 Cys_Met_Meta_PP AF2212-like
Other DBs
NCBI-GeneID: 4348231
NCBI-ProteinID: XP_015612907
UniProt: Q7G4P2
LinkDB
Position
10:complement(6208954..6214147)
AA seq 482 aa
MMEMVLPVANATAAALARVSAVFNAPLARAVVFGIHIDGHLVVEGLLIAAILFQLSRKSY
KPPKKPLTEREVDELCDDWQPEPLCPPIKEGARIDTPTLESAAGPHTTVDGKEVVNFASA
NYLGLIGNEKIIDSCVGSVEKYGVGSCGPRSFYGTIDVHLDCESKIANFLGTQDSILYSY
GISTIFSVIPAFCKKGDIIVADEGVHWAVQNGLQLSRSTVVYFKHNDMASLASILEKLTH
GNKHTEKIRRYIVVEAIYQNSGQIAPLDEIVRLKEKYRFRVILEESHSFGVLGKSGRGLA
EHYGVPVEKIDIITAGMGNALATDGGFCTGSVRVVDHQRLSSSGYVFSASLPPYLASAAM
SAVNHLEENPSVLANLRSNIALLHKELSDIPGLEIASNILSPIVFLKLKTPTGSAVADLE
LLEIIAEKVLMEDSVFIAATKRSSLDKCRLPVGIRLFVSAGHTESDIFKVSASLKRVAAS
VV
NT seq 1449 nt   +upstreamnt  +downstreamnt
atgatggaaatggtattgccagtcgcgaatgctacggctgcggcacttgcacgggtttct
gctgtgttcaatgccccacttgcccgtgctgttgtctttgggattcatattgatggacat
ttggttgtggaagggcttctcattgctgccatactgtttcagctctccaggaagagctac
aaacctccaaagaagccactcactgagagggaggttgatgagctctgtgatgactggcaa
ccggagcctctatgcccacccatcaaggaaggagcacggatcgacacgcctacattagaa
agtgctgctggacctcatacaactgttgatggaaaagaagttgtaaactttgcatcagca
aactaccttggtttgattggcaatgaaaagataattgattcctgtgttggctcagtggag
aaatatggtgttggatcatgtggaccacgaagcttttatggaactattgatgtgcacctt
gactgcgagagtaaaatagcaaatttcctgggaacccaagattcaatcttgtactcctat
gggatatcaaccatcttcagtgtaattcctgccttttgcaagaagggagatatcattgta
gctgatgagggtgttcactgggctgtgcaaaatggtttacagctttcaagaagcactgtt
gtatatttcaagcataatgacatggcttcacttgcgagcattttggaaaaactaactcat
ggaaacaaacatacagaaaagattaggcgctatattgttgtggaagctatttaccagaat
tctggccaaattgctcccttggatgagatagttcggttgaaggagaaataccggtttcgt
gttatattggaggagagccattcttttggtgttcttggcaagtctggacgtggccttgct
gaacactatggagttcctgtggaaaaaatagacattattactgctggaatgggaaatgcg
ttagctaccgatggtggtttttgtacaggaagtgtcagagttgttgatcatcagcgtcta
agcagctctggttatgttttttctgcctcgttgccaccataccttgctagtgcagcaatg
tctgctgtgaaccacctggaggagaacccatcagttctcgccaatctaagatcaaacatc
gcccttctgcataaagagttgtcagatatacccgggctcgaaattgctagcaatatcttg
tcacctattgtctttctcaaattgaagacaccaaccggttctgctgttgctgacctggaa
ctccttgagattattgcagagaaggtcttgatggaagattcagtcttcattgcagcaaca
aagaggtcgagtttggacaagtgtcggctcccggttggaatccgcttattcgtgtcagct
ggtcacactgaatctgacatcttcaaagtatctgcatccctgaagagggttgcagcatca
gttgtctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350591
Entry
4350591           CDS       T01015                                 
Name
(RefSeq) long chain base biosynthesis protein 2a
  KO
K00654  serine palmitoyltransferase [EC:2.3.1.50]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00600  Sphingolipid metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    4350591
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4350591
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.50  serine C-palmitoyltransferase
     4350591
Amino acid related enzymes [BR:osa01007]
 Aminotransferase (transaminase)
  Class II
   4350591
SSDB
Motif
Pfam: Aminotran_1_2 Aminotran_5 Beta_elim_lyase DegT_DnrJ_EryC1 COA2
Other DBs
NCBI-GeneID: 4350591
NCBI-ProteinID: XP_015617901
UniProt: Q2R3K3
LinkDB
Position
11:18503524..18507720
AA seq 488 aa
MVRLPYTTALTTLFSYGLLFAFGQLRDFFRKLIDWFKAKNVKGYAPICLGLEDFYVRRLY
LRIQDCFGRPIASAPDAWFDVVERYSNDSNKTLKRTSNTTRCLNLGSYNYLGFAAADEYC
TPLVIESLKKYSPSTCSVRVDGGTTKLHTELEELVARFVGKPAAILFGMGYVTNSAIIPC
LVGKGGLIISDSLNHNSIVNGARGSGATVRVFQHNSPAHLEEVLREQIAGGQPRTHRPWK
KIIVIVEGIYSMEGELCKLPEIIAVCKKYKAYTYLDEAHSIGAVGQSGRGVCELLGVDPA
DVDIMMGTFTKSFGSCGGYIAASKEIIQHLKLSCPAHIYATSMSPPAVQQVISAIKVILG
EDGSNRGAQKLARIRENSNFFRSELKKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLR
QKVAVVTVAFPATPLLLARARICISASHTREDLIKALDVISRVGDLVGIKYFPAEPPKIA
EADHDKLE
NT seq 1467 nt   +upstreamnt  +downstreamnt
atggtgaggctgccgtacaccacggcgctgacgacgctcttcagctacgggctgctcttc
gcgttcggccagctcagggatttcttccgcaagctcatcgattggttcaaggccaagaac
gtcaagggctacgcgccgatctgcctcggcctggaggatttctacgtgcgccgcctgtac
cttcggatccaggattgcttcggtaggcccatagcaagtgcaccagatgcttggtttgat
gttgttgagcgctactccaatgacagtaacaagacattaaagcgtacttcaaataccaca
agatgcctcaacctaggatcctacaattaccttggatttgcagcagcagatgagtactgc
actccacttgtgatcgagtctctcaagaaatactcacccagcacctgcagtgttcgcgtt
gatggcggcacgaccaaacttcacactgagttggaggagttggttgcacgctttgttgga
aagcctgctgctatcctatttggcatgggttatgttacaaactcggccatcattccttgc
ctagtaggaaagggtgggctgataattagtgactcactgaaccataactcaattgtcaat
ggtgcaagaggatccggtgcaaccgttcgggttttccagcataactcccctgctcatttg
gaagaggtcctgagagagcagatagctggtggtcaaccacgcacacacagaccttggaaa
aagatcattgtcattgttgagggtatctacagcatggaaggcgagctgtgcaaactacct
gagatcatagctgtatgcaagaaatacaaggcttacacttatctggatgaggcccatagc
attggcgctgttggccagtctggtcggggtgtttgtgagctccttggggttgatccagct
gatgtggacataatgatgggcactttcactaagtcatttggatcatgtggtggatatatt
gcagcatcgaaggagataattcagcacctgaagcttagctgcccagcgcatatttatgct
acctccatgtcaccaccagcagtacaacaagttatttcagccattaaagtgatccttgga
gaggatggctccaacagaggtgcccagaaacttgcacgcatccgtgagaacagcaatttc
tttaggtcagagctcaagaagatgggttttgaggttctcggagacaatgactctccagtt
atgccaataatgctctacaatccagccaaaattccagctttttccagggagtgccttaga
caaaaggttgctgttgtcactgtggcattccctgccacacctctgctccttgcaagggcg
cgcatctgcatttctgcttcgcacactagggaggacctgataaaagcccttgatgttatc
agcagagttggtgatcttgtgggcatcaagtacttccctgcggagccgccaaagattgct
gaagctgatcacgataagctggagtaa

DBGET integrated database retrieval system