KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327020
Entry
4327020           CDS       T01015                                 
Name
(RefSeq) malonate--CoA ligase isoform X1
  KO
K18660  malonyl-CoA/methylmalonyl-CoA synthetase [EC:6.2.1.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00061  Fatty acid biosynthesis
osa00280  Valine, leucine and isoleucine degradation
osa01100  Metabolic pathways
osa01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    4327020
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    4327020
Enzymes [BR:osa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-
     4327020
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 4327020
NCBI-ProteinID: XP_015621756
LinkDB
Position
1:32025967..32032642
AA seq 641 aa
MRAQAWVRGAVARLMTPFNCPAAHASSSPYHLLLLPCSSYSLLSRLRRHFASSSSSSSSR
SSSPAYNTTQNTTSTFMEVVQEVLKHGSTQGVHAAIRSDQKSYNLVQLIASALDVYNILR
NKNVPPLSFSMTQNGSTGSSVKGINGTGFLGGARIGIVAKPSPEFVAGIFGTWLSGGVAV
PLALSYPEAELLHVMNDSDISLILSTKEHQDIMENISTKCSAHCSLLPSVTSIPVNIDCQ
EPSSTEVTSSISSLIAEIDSSKEIRGDDPALILYTSGTTGKPKGVVHTHKGIVSQVQILS
EAWGYRSEDQFLHCLPLHHVHGLFNALFAPLYSGSVVEFMPKFSVRGIWQRWRESYPNNG
SKNDEAITVFTGVPTMYTRLLQGYDGMDPEQQSASSFAAKQLRLMMCGSSALPSPLMKRW
EEVTGHRLLERYGMTEFVMALSNPLHGARKEGTVGKPLPCVEAKIIMEDGAETTSEVGEL
CIRSPSLFKEYWRKPEVTAESFIDGGFFKTGDTVTVDDEGYFIILGRTNADIMKVGGYKL
SALEIESVLLQHEIVLECAVLGLPDEAYGEIICAIIVPKEDSKKRAELDSKPALTLEALT
SWSKDKLAPYKIPTRLYLWDSLPRNAMGKVNKKELKKLLGA
NT seq 1926 nt   +upstreamnt  +downstreamnt
atgcgcgcacaggcgtgggtgcgcggggcggtggcgcgcttgatgacgccattcaattgc
cccgcggcccacgcctcctcctccccctaccacctgctcctcctcccctgctcctcttat
tccctcctctctcgcctccgacgccacttcgcctcctcctcctcctcctcctcctcccgc
tcctcctcgccagcttacaacaccacacaaaatactactagtacgttcatggaggttgtt
caggaagtccttaagcatggttcgacacaaggtgtccatgcagccatcagatctgaccaa
aagagttataaccttgtccagctcattgcatctgcactggatgtctacaatattctgcgc
aataaaaatgtaccaccgctctccttctctatgacacagaatggaagtacaggttcatct
gtcaaaggaataaatggaactggattccttggtggagctcgtattggcatagtggctaaa
ccttctcctgaatttgttgccgggatatttggaacctggctttctggtggagttgcagtg
cctctagcacttagctatcctgaagctgaactccttcatgtcatgaatgactcggacatt
tcgctgattttaagcaccaaggagcatcaagacatcatggagaatatctctaccaaatgt
tctgctcactgttctcttcttccatctgtgacaagtataccagtaaatatagattgccaa
gaaccatcaagtactgaagtgacttcgtctatttctagcttaatagctgagattgacagt
tcaaaggaaatcagaggagatgatcctgctctcatcctttacacaagtgggacaactggt
aaaccaaaaggagtggtccacactcataaggggatagtctctcaggttcaaattctgtca
gaggcatggggatatcgaagtgaagatcaatttctgcactgtctcccactgcaccatgtt
catggcctgttcaatgctctatttgcacccctctattctggatcagtggttgagttcatg
ccgaaatttagtgtgaggggaatatggcagaggtggcgtgagtcatatcccaacaatggc
agtaaaaatgatgaagcaattacagtatttactggagttccaacaatgtacacacggcta
ttgcaagggtatgatggtatggatcctgaacaacagtctgcatcttcctttgctgcaaag
caattgaggctaatgatgtgtggatcatcggcccttccttccccacttatgaaacggtgg
gaggaagtgacaggtcaccgtcttttggaacgatacggcatgactgagtttgtcatggca
ctgtctaacccattgcatggtgcacgtaaagaaggtacagttggcaaaccgcttccgtgt
gttgaggccaagattattatggaggatggggctgaaactacatctgaagttggcgagctt
tgtattagaagtccatccctttttaaggaatattggagaaaaccagaggttactgcagaa
tcatttattgatggtgggttcttcaagactggtgatacagtaactgtagacgatgaagga
tatttcataattttagggcgcacaaatgctgacatcatgaaagttggtggttataagctg
tctgcattagaaattgagtcagtgctgttacagcatgaaattgtcctggaatgtgctgtt
ctcggcttacctgacgaagcttatggagagattatctgtgcaataattgtgcctaaggag
gactcaaagaaaagagctgaactggactcgaaaccagcactgaccttggaagcactgaca
agttggtcaaaagataagcttgctccatacaagattcctacgaggttgtacttatgggat
tcgcttcctcggaatgccatgggaaaggtcaacaagaaggagctgaagaaattattagga
gcttag

DBGET integrated database retrieval system