KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327023
Entry
4327023           CDS       T01015                                 
Name
(RefSeq) triacylglycerol lipase SDP1
  KO
K14674  TAG lipase / steryl ester hydrolase / phospholipase A2 / LPA acyltransferase [EC:3.1.1.3 3.1.1.13 3.1.1.4 2.3.1.51]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00100  Steroid biosynthesis
osa00561  Glycerolipid metabolism
osa00564  Glycerophospholipid metabolism
osa00565  Ether lipid metabolism
osa00590  Arachidonic acid metabolism
osa00591  Linoleic acid metabolism
osa00592  alpha-Linolenic acid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00089  Triacylglycerol biosynthesis
osa_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    4327023
   00561 Glycerolipid metabolism
    4327023
   00564 Glycerophospholipid metabolism
    4327023
   00565 Ether lipid metabolism
    4327023
   00590 Arachidonic acid metabolism
    4327023
   00591 Linoleic acid metabolism
    4327023
   00592 alpha-Linolenic acid metabolism
    4327023
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.51  1-acylglycerol-3-phosphate O-acyltransferase
     4327023
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.3  triacylglycerol lipase
     4327023
    3.1.1.4  phospholipase A2
     4327023
    3.1.1.13  sterol esterase
     4327023
SSDB
Motif
Pfam: DUF3336 Patatin
Other DBs
NCBI-GeneID: 4327023
NCBI-ProteinID: XP_015621385
UniProt: Q94DR5
LinkDB
Position
1:complement(32058306..32062910)
AA seq 1044 aa
MDAISSEAPVGVFAIGPSTALGRALALRVLLCGSLGRLRHRLAAALRAALPVAAGWLHPR
DNTRGILLAVCAVALLLRVRGRGGGRAGVRARVQSAYRRKFWRNMMRAALTYEEWAHAAR
MLDRETPRRATDADLYDEELVRNKLRELRHRRQEGSLRDIVFCMRADLLRNLGNMCNSEL
HKGRLQVPKLIKEYIEEVSTQLKMVCNSDSDDLPLEEKLAFMHETRHAFGRTALLLSGGA
SLGCFHVGVVKTLVEHKLLPRIISGSSVGSIMCSIVATRSWPELESFFEEWHSLKFFDQM
GGIFPVVKRILTHGAVHDIRHLQTLLRNLTSNLTFQEAYDMTGRILVVTVCSPRKHEPPR
CLNYLTSPHVLIWSAVTASCAFPGLFEAQELMAKDRFGETVPFHAPFLLGLEERVGATTR
RWRDGSLESDLPMKQLKELFNVNHFIVSQANPHIAPLLRLKEIIRAYGGSFAAKLAELAE
MEVKHRCNQILELGFPLGGIAKLFAQDWEGDVTVVMPATLAQYSKIIQNPSYAELQKAAN
QGRRCTWEKLSAIRANCAIELVLDECVALLNHMRRLKRSAERAAASQGHGPTIRLCPSRR
IPSWNLIARENSSGSLEEEFLISPRTNHHADGGIAGPSNKNHHVQQNVHDGSDSESESID
LNSWTRSGGPLMRTASANKFVSFVQNLEIDTEFRTISSREDRTDVVTPNANFLVSQAIGR
ESVDNSAMPITPDRSLGNSGYDPHDSNVPRSPFGCSTSIMVSEGDLLQPEKIENGILFNV
VKRDTLLTPTGGVELQGTSQEPDVETIQTECLDDASDDDDVGLNAGDEAAIDPRANMSSQ
NTQHQGSSLENINLSSSVDCEAETITSKSKGSSLFDIGMEIRPTILSTESSMYERSSAKI
GLRTVHAEFISNPGAGKGEVDSGAANKEFSYFSQTADTVIFSESCETGQHHEVNVEALTS
YPVSVLEDDRSGGFNLSEIMATTFIAEADAPISRRDEVEQHNGSPVETFLDTETVQAGPC
SSTLEGNNTNNSEEMQVVCTSGTN
NT seq 3135 nt   +upstreamnt  +downstreamnt
atggacgcgatcagcagcgaggcgccggtgggggtgttcgcgatcggcccgtccacggcg
ctgggccgcgcgttggcgctgcgggtgctgctctgcggctccctggggcggctgcgccac
cgcctcgccgcggcgctgcgggccgcgctccccgtggcggcgggctggctgcacccgcgg
gacaacacccgcgggatcctgctcgccgtctgcgccgtcgcgctcctgctgcgggtgcgg
gggcggggcggcgggcgcgccggggtccgggcgcgggtgcagtccgcgtaccggcgcaag
ttctggcggaacatgatgcgcgccgcgctcacctacgaggagtgggcgcacgccgcgcgg
atgctggaccgcgagaccccgcgccgcgccaccgacgccgacctctacgacgaggagctc
gtgcgcaacaagctccgcgagctcaggcaccgccgccaggagggctcgctcagggacatc
gtcttctgcatgcgcgccgacctgctcaggaatctcggcaacatgtgcaactccgagctc
cacaaggggaggctgcaggtgccgaaactcataaaggagtacattgaggaagtatctact
cagctgaaaatggtatgtaattctgattcagacgacttgcctctcgaagagaaacttgca
tttatgcatgagacaagacatgccttcggtagaacagccttgctgctaagcgggggtgct
tctctaggttgtttccatgtgggtgttgtgaaaacattggtagaacataagcttctgcca
aggataatttcaggatctagcgttggttctataatgtgctccatagtagcaacaaggtca
tggccagagctggagagctttttcgaggagtggcattccttgaagttctttgaccagatg
ggcgggatctttcccgtagttaaaaggattttgactcatggagctgttcatgacattaga
catttgcagacgcttttgagaaatcttaccagcaatttgacattccaagaggcctatgac
atgacgggccggattcttgttgtcactgtgtgttctccaaggaagcatgagccacctcga
tgcctgaactatttgacatcacctcatgttctcatctggagtgcagtaactgcttcctgt
gcttttcctggtctttttgaggcccaagagttgatggcaaaagacagatttggagaaaca
gttccttttcatgctcctttcctgttgggcttggaagaaagagttggtgctacaactcgg
cgttggagagatgggagcttggaaagtgatttgccaatgaagcaattgaaggaattattc
aatgtgaatcatttcatagtaagccaagccaatcctcacatagctccactgttgagactc
aaggaaattatcagggcttatggaggcagttttgctgccaagttggctgaacttgctgag
atggaagttaagcataggtgcaaccaaattctcgaacttggatttcctttaggaggaata
gccaagttgtttgctcaagattgggaaggtgatgtcacagttgttatgccagccacgctt
gctcagtattccaagatcatacagaatccatcttacgctgagcttcagaaggctgcaaat
cagggtaggcgatgcacctgggagaagttatcagccattagggcaaattgtgctattgag
ctggtactagatgaatgtgttgccctgttgaaccatatgcgtaggctaaagagaagcgcg
gaaagagcagcagcttcacaaggacatggtcctacaatcagactctgcccatctagaagg
attccatcatggaatctcatagcaagagaaaattcatctggttcccttgaagaagaattc
cttatatctcctcgtacaaaccatcatgcagatggaggaattgctggaccatctaacaaa
aaccatcatgtccaacaaaatgtacatgatggcagtgacagtgaatctgagagtatagac
ttaaactcatggacaagaagtggtggccctcttatgaggacagcctcagccaacaaattc
gtcagttttgttcagaatcttgagattgacacagagttcagaacaatttcatcgagggaa
gacagaactgatgttgtaacaccaaatgctaatttcttggtttctcaggcaattggtaga
gaatctgttgacaacagtgcaatgcctattactcctgataggagcttgggcaattcaggt
tatgatcctcatgatagtaatgtccctagatctccatttggttgttcaacaagtatcatg
gtttctgaaggcgacttactgcaacccgaaaagattgaaaatggtattctgtttaatgtt
gtgaaaagggatactcttctaacacctacaggtggagttgagcttcagggaacatcgcag
gaaccagacgtggaaacaattcagacagagtgccttgatgatgcttcggatgacgacgat
gtgggattaaatgctggtgatgaagcagcaattgaccctagagcaaacatgagcagccaa
aatacacaacaccaggggtcttcactagaaaatataaatctgtcctcttcagtagattgt
gaagctgaaacaattactagtaaatcaaagggttcatctctttttgatattggtatggag
attcgtccaacaatcttgagcacggaaagtagtatgtacgagaggtcttctgcaaaaata
ggactgaggacagtgcatgcagaatttatcagcaatccaggtgctgggaagggagaagtt
gactcaggggctgctaataaagaattttcctatttttctcaaacagcagatactgttata
ttttcagaaagctgtgaaactgggcaacatcatgaagtgaatgtagaagctttaacctca
taccctgtttcagttctggaagatgataggtctggtggcttcaatttgagtgaaataatg
gctacaactttcattgccgaagctgatgctccaatatctagaagagatgaagttgagcag
cataacggatctccagtggaaacattcctggacacagaaacggtacaagctgggccttgc
agttctactttggagggcaacaacaccaacaattccgaggaaatgcaagttgtttgcacc
tcaggaaccaattag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327848
Entry
4327848           CDS       T01015                                 
Name
(RefSeq) probable 1-acyl-sn-glycerol-3-phosphate acyltransferase 5
  KO
K13513  lysocardiolipin and lysophospholipid acyltransferase [EC:2.3.1.- 2.3.1.51]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa00564  Glycerophospholipid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4327848
   00564 Glycerophospholipid metabolism
    4327848
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4327848
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.51  1-acylglycerol-3-phosphate O-acyltransferase
     4327848
    2.3.1.-
     4327848
Lipid biosynthesis proteins [BR:osa01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   4327848
SSDB
Motif
Pfam: Acyltransferase Acyltransf_C
Other DBs
NCBI-GeneID: 4327848
NCBI-ProteinID: XP_015622067
UniProt: A0A8J8YM00 Q0JIR6
LinkDB
Position
1:complement(33154298..33158322)
AA seq 399 aa
MNGSSGSQGHNVNGGQKKVQHASPLTLNNGSKHRPLTPMRRCRGVACVVIILSTAFTLIV
FIAPITTFLVRLVSVHYSRKATSVLFGMWLSLWPFLFEKINKTNVVFSGESVLPKKRVLL
FANHRTEVDWMYLWDLALRKGYLGYIKYILKSSLMKLPVFSWAFHIFEFIPVERKWEIDE
AIIQNKLSAFKDPRDPLWLAVFPEGTDYTEKKCIKSQEYASEHGLPILKNVLLPKTKGFL
CCLQELKSSLDAVYDVTIAYKHRLPDFLDIIYGTDPSEVHIHIRTVKLCDIPTSEDEVTD
WMIERFRQKDQLLSDFFMQGHFPDEGTEGDVSTPECLANFIAIVSSTGFFLYLSLFSSVW
FKVYVLLSCAYLTFVTYFSIQPPQLICSSEGGTHAKKVL
NT seq 1200 nt   +upstreamnt  +downstreamnt
atgaatggttcaagtggctcccaaggacataatgtcaatggaggacagaagaaagtgcag
catgctagcccactcactctgaacaatgggtcaaagcaccgtccattgactcccatgaga
cgatgccgcggtgtagcatgtgtggtgatcatactgtcaacagcattcacattgatagtt
ttcatagcccctattactactttccttgttcggctagtcagcgtgcattacagtagaaag
gcgacctctgttctgtttggaatgtggctatctttatggccattcttgtttgagaagatc
aacaagaccaatgtggttttctctggtgaaagtgtacttccaaaaaagcgtgtcttgtta
tttgccaaccacaggactgaggttgactggatgtatttgtgggatcttgcattgaggaaa
ggctatttaggatatatcaagtacatccttaagagcagcttgatgaaattgcctgttttt
agctgggcatttcacatttttgagtttatcccagtagaacggaaatgggagattgatgaa
gcaattatccagaacaaactgtcagcatttaaggaccccagagaccccctctggttggcc
gttttccctgagggcactgattatactgagaagaaatgcatcaagagtcaagaatatgct
tcggagcatggtctgcctatacttaaaaatgttcttcttccaaagacaaaggggttcctt
tgctgtttgcaagagttgaagagctccctagatgcagtttatgatgtcacaatagcgtat
aagcatcgcctgccagattttctggatattatatatggcaccgatccttctgaagtccac
atccacatcagaactgttaagctctgtgacattccaacgtcagaagatgaagtaaccgat
tggatgatagagaggttcaggcagaaggaccagcttctgtcagattttttcatgcaaggc
cacttccctgatgaaggaactgaaggggatgtatccacaccggagtgccttgctaatttc
attgcaatagtcagctcgacaggcttcttcttgtacctatctcttttttcgtctgtgtgg
ttcaaggtctatgtattattaagctgcgcttaccttacatttgttacctatttctccatt
caaccaccccaactgatatgctcatcagagggtggaacccatgccaaaaaggtactgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330302
Entry
4330302           CDS       T01015                                 
Name
(RefSeq) lysophospholipid acyltransferase 2
  KO
K13519  lysophospholipid acyltransferase [EC:2.3.1.51 2.3.1.23 2.3.1.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa00564  Glycerophospholipid metabolism
osa00565  Ether lipid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4330302
   00564 Glycerophospholipid metabolism
    4330302
   00565 Ether lipid metabolism
    4330302
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4330302
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.23  1-acylglycerophosphocholine O-acyltransferase
     4330302
    2.3.1.51  1-acylglycerol-3-phosphate O-acyltransferase
     4330302
    2.3.1.-
     4330302
Lipid biosynthesis proteins [BR:osa01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   4330302
SSDB
Motif
Pfam: MBOAT
Other DBs
NCBI-GeneID: 4330302
NCBI-ProteinID: XP_015626464
UniProt: A0A0P0VMV6
LinkDB
Position
2:27559210..27566963
AA seq 459 aa
MGLEMEGMAAAIGVSVPVLRFLLCFAATIPTGLMWRAVPGAAGRHLYAGLTGAALSYLSF
GATSNLLFVVPMAFGYLAMLLCRRLAGLVTFLGAFGFLIACHMYYMSGDAWKEGGIDATG
ALMVLTLKIISCAINYSDGMLKEEGLRDAQKKYRLAKLPSLIEYFGYCLCCGSHFAGPVY
EMKDYLEYTERKGLWASPTPSPLLPTLRALVQAGACMGLYLYLSPQFPLSRFSEPLYYEW
GFWHRLFYQYMSGFTARWKYYFIWSLSEAAIIISGLGFSGWSDSSPPKAKWDRAKNVDVL
GVELATSAVQLPLMWNIQVSTWLRYYVYERLVQKGKKPGFLQLLGTQTVSAVWHGLYPGY
IIFFVQSALMINGSKVIYRWQQAVSNPVFHAILVFVNFSYTLMVLNYSCIGFQVLSFKET
LASYQSVYYIGTIVPIVVVLLGYVIKPARPVKPKARKAE
NT seq 1380 nt   +upstreamnt  +downstreamnt
atggggctggagatggaggggatggcggcggcgatcggcgtgtcggtgcccgtgctccgc
ttcctgctctgcttcgcggccaccatcccgacgggcctcatgtggcgggcggtgcccggc
gccgcggggcggcacctctacgcggggctcaccggcgccgcgctttcctacctctcgttc
ggggccacatccaacctcctcttcgtcgtgcccatggcgttcgggtacctcgccatgctc
ctctgccgccggctcgcggggctcgtcaccttcctcggcgccttcggcttcctcatcgca
tgtcacatgtactacatgagtggagatgcatggaaggagggtggcattgatgcaacaggt
gctttaatggttttaacattgaaaatcatttcatgtgcaataaactacagtgacggtatg
ttgaaggaagagggtttgcgtgatgcccagaaaaagtatcgtttggctaaacttccttct
ttgatcgaatattttggctactgcctctgctgtggcagccattttgctgggccagtatat
gagatgaaagattatcttgaatatactgaacggaaaggattatgggccagcccaactcct
tcaccactattgcctactttgcgtgctctagttcaagctggcgcatgtatggggttatat
ttgtatctatcacctcaatttccactttcacggtttagcgagcccttatattatgagtgg
ggtttctggcaccggctcttctatcagtacatgtcaggctttactgctcgttggaaatac
tactttatatggtcactttcagaagctgcaatcattatatctggtctgggttttagcggc
tggtctgattcatctcccccgaaagccaaatgggatcgtgcaaaaaatgttgatgtttta
ggtgtcgaattagctacaagtgcagttcagttgccgcttatgtggaacattcaagtgagc
acatggctgcgatactatgtttatgagaggttagttcagaaaggaaagaaacctggtttc
ctccagttgctgggtacacagacagtcagtgctgtctggcatggtctttatcccggatat
atcatattctttgttcaatcagcattgatgataaatggttcaaaagtcatatacagatgg
caacaagcagtcagcaatccagtcttccacgctatcctggtttttgtaaatttttcatac
accttgatggtccttaactactcatgtattgggttccaggtactgagcttcaaggaaacc
ctagcatcctaccagagcgtatattatatcggcacaattgttcccattgtagttgtcttg
ctgggttatgttatcaagccagccaggccagtgaagccaaaggctcggaaggcagaatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334536
Entry
4334536           CDS       T01015                                 
Name
(RefSeq) triacylglycerol lipase SDP1
  KO
K14674  TAG lipase / steryl ester hydrolase / phospholipase A2 / LPA acyltransferase [EC:3.1.1.3 3.1.1.13 3.1.1.4 2.3.1.51]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00100  Steroid biosynthesis
osa00561  Glycerolipid metabolism
osa00564  Glycerophospholipid metabolism
osa00565  Ether lipid metabolism
osa00590  Arachidonic acid metabolism
osa00591  Linoleic acid metabolism
osa00592  alpha-Linolenic acid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00089  Triacylglycerol biosynthesis
osa_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    4334536
   00561 Glycerolipid metabolism
    4334536
   00564 Glycerophospholipid metabolism
    4334536
   00565 Ether lipid metabolism
    4334536
   00590 Arachidonic acid metabolism
    4334536
   00591 Linoleic acid metabolism
    4334536
   00592 alpha-Linolenic acid metabolism
    4334536
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.51  1-acylglycerol-3-phosphate O-acyltransferase
     4334536
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.3  triacylglycerol lipase
     4334536
    3.1.1.4  phospholipase A2
     4334536
    3.1.1.13  sterol esterase
     4334536
SSDB
Motif
Pfam: DUF3336 Patatin
Other DBs
NCBI-GeneID: 4334536
NCBI-ProteinID: XP_015631080
UniProt: Q0DMF7 Q7XZH2
LinkDB
Position
3:complement(33941623..33946142)
AA seq 820 aa
MDLSGEASLGGFKIGPSTLVGRGVAIRVLLLSSLWRLRERAYAAASRVRGAALPVVAPWL
HLRNTHGILLVVVLFALFLRRLSGARSRAALARRRLQCKKAMRYAASYEEWARAAKVLDK
MSEQVSESDFYDEELIRNRLEELRRRREEGSLRDVVFCMRGDLVRNLGNMCNPELHKGRL
EVPKLIKDYIDEVSAQLKMVCESDTDDLLLEEKLAFVQETRHAFGRTALLLSGGASLGSF
HVGVVKTLVEHKLLPRIVAGSSVGSIICSIVATRTWPEIQSFFVDSLQTLQFFDRIGGIF
AVTKRVMTYGALHDISQMQRLLRDLTGNLTFQEAYDMTGRVLGVTVCSPRKNEPPRCLNY
LTSPHVVIWSAVTASCAFPGLFEAQELMAKNRFGEIVPFHAPFSTDPEQGPGASKRRWRD
GSLEMDLPMMQLKELFNVNHFIVSQTNPHISPLLRLKEIVTTYGGRFAGKLARLAEMEVK
YRCNQILEIGLPLGGLAKLFAQDWEGDVTMVMPATAAQYLKIIQNPTYAELQMAANQGRR
CTWEKISAIRTNCAIELALDESIAVLNHKRRLKRSMERVASASQGYTCSSVIRTPRRVPS
WSCISRENSTGSLSEDCFATTSSSTHQGIQVVATPNVIHNDGSESESETIDLNSWTRSGG
PLMRTSSADMFINFIQNLEIESEFNTGNSSGSTVSKDSCPNNNSGVTAQGTDRSTDTSET
GSCNTGNNIASQPSTSTSIAVSEGELLQPERSTNGILINVVKRKSVFGEHESEAETESYV
DTTNLDTSDCPGDNKDAADSNDLSAAHTDSVTSQHSSADE
NT seq 2463 nt   +upstreamnt  +downstreamnt
atggatttgtccggggaagcaagcctcgggggattcaagatcgggccatcgacgctcgtc
ggccgcggggtagccatccgcgtgctcctcctcagctcgctgtggcgcctgcgcgagcgc
gcctacgccgccgcctcgcgcgtgcgcggcgcggcgcttccggtggtcgcgccctggctc
cacctcaggaacacccatggcatcctcctcgtggttgtcctcttcgcgctgttcctgagg
cggctctctggcgcgcggtcgcgggcggcgctggcgcgccggcggttgcagtgcaagaag
gcgatgaggtacgcggcgagctacgaggagtgggcgcgcgccgccaaggtgctcgacaaa
atgtctgagcaggtcagtgagagcgatttctacgacgaggagctcatcaggaacaggctg
gaggagctccgaaggcggagggaggaagggtcgctccgggatgtggtgttctgcatgcgt
ggtgatcttgtgaggaatttggggaacatgtgcaatcccgagcttcataagggcaggctt
gaggttcctaagcttataaaagattacattgatgaggtttctgcccagctgaaaatggta
tgtgaatctgataccgatgatttgcttttggaagagaaacttgcctttgttcaagagacc
aggcatgcctttgggaggacagcattactcttaagtgggggtgcttcactgggatctttt
catgtaggtgtagtgaaaacactggttgagcacaagcttttgcctcgaatagttgcagga
tctagtgttggttccattatatgttcaattgttgcgacccgaacatggcctgagatccag
agcttctttgtagactcattgcagaccttgcagttctttgataggataggtggaattttt
gcagtaacaaaacgggttatgacttatggtgcactccatgacattagccagatgcaaagg
cttttgagggatctgacaggcaacttaacatttcaagaggcttatgacatgactggccgt
gttcttggcgtcacagtttgctctcctagaaaaaatgagccaccccgctgcctcaactac
ctgacatcaccacatgttgttatttggagtgccgtgactgcctcttgtgcatttcctggg
ctcttcgaagctcaggaattgatggcaaagaatagatttggtgagatagttcccttccac
gcacccttttccacagacccagagcaaggtcctggagcatcaaagcgtcggtggagggat
ggaagtttggagatggatctgcccatgatgcaactcaaagagttgttcaacgtaaatcac
ttcattgtgagccaaactaatcctcacatctctccactcctccgactgaaggagattgtc
acaacctatggaggtcgcttcgctggaaagcttgctcgtctggctgaaatggaggttaag
tacagatgtaaccaaatcctagaaattggcctcccactgggaggactagcgaaattgttt
gctcaggattgggagggtgatgtcaccatggttatgccggcaacagcagcccagtacttg
aagattatacaaaaccctacatatgcggagctgcaaatggctgccaaccaggggcgcagg
tgcacatgggagaagatctctgcgatcagaacaaactgtgctattgaacttgcgttggat
gagtccattgccgttctaaaccataaaagaagactaaagagaagcatggaaagggtagct
tctgcttcccagggatatacatgcagttctgtaatcagaacaccaaggagggtaccatcg
tggagctgcatcagtcgagagaattctacaggatctctctcagaagattgttttgcaacc
actagttcatctactcaccaaggaattcaagttgttgccacaccgaacgttattcataat
gatggaagtgagagtgaatcagaaaccattgacttaaattcttggacccggagtggtgga
cctctaatgaggacttcatcagctgacatgttcatcaatttcattcagaatcttgagata
gagtctgagttcaatacaggtaattcatcaggatctaccgtttctaaagattcatgccca
aacaataattctggagttactgcacaaggtacagatagaagcacagacacatctgaaact
ggttcatgcaatactggcaacaatatagctagtcaaccctctacctctacaagcattgct
gtttctgaaggagaactgctgcaaccagaaaggagtactaacggaattctaattaatgtt
gtcaaaagaaagagtgtgtttggtgagcatgaaagcgaagctgaaaccgaatcatatgtg
gacacaacaaatttggacacttctgactgtcctggagataacaaagatgcagctgactca
aacgatctttcagctgctcatactgattctgtgacttcacaacattcttcagctgatgaa
tag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339242
Entry
4339242           CDS       T01015                                 
Name
(RefSeq) probable 1-acyl-sn-glycerol-3-phosphate acyltransferase 5
  KO
K13513  lysocardiolipin and lysophospholipid acyltransferase [EC:2.3.1.- 2.3.1.51]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa00564  Glycerophospholipid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4339242
   00564 Glycerophospholipid metabolism
    4339242
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4339242
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.51  1-acylglycerol-3-phosphate O-acyltransferase
     4339242
    2.3.1.-
     4339242
Lipid biosynthesis proteins [BR:osa01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   4339242
SSDB
Motif
Pfam: Acyltransferase Acyltransf_C
Other DBs
NCBI-GeneID: 4339242
NCBI-ProteinID: XP_015638306
UniProt: A0A0N7KL18 Q60EI7
LinkDB
Position
5:24724315..24727260
AA seq 397 aa
MMNGSNGSQGYHVNGKQVQSVVPSIQNNGPRHRPLTLMRRCRGMLCLVIMPLTAFMMMVY
LSPVTTFLIRLFSVHYSRKSTCFLFGMWLAMWPFLFEKINKTKFVFSGETVPPKERVLLF
ANHRTEVDWMYLWDLALRKGRLQCIKYILKKSLMKLPIFNWAFHIIEFIPVERKWEVDEP
LIRSRLSELKNPKDPLWLAVFPEGTDYTEKKCIKSQEYAKEHGLPILNNVLLPKTKGFHC
CLQELRDSMDSVCDITIAYKHRPPTFMDNVYGIDPSEVHIHVKIIQVSDIPTSEDEVADW
LIERFKLKNKLLSDFSALGHFPNEGTEDDLSTLKCIANFVAVISTTTVLTYLTLFSSVWF
KIFVAFSSAFLTFATLYSIHLPQLICSPEAGTHAKKS
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgatgaatggttcaaatggttcccaagggtatcatgtgaatggaaagcaagtgcaaagc
gttgttccttccattcagaacaatggaccaagacaccggccattgactctaatgagacgg
tgccgtggcatgttatgtttggttattatgccgttgacagcatttatgatgatggtttac
ctatcccctgtaactactttcctcatacggttgttcagtgtgcattacagcagaaagtcg
acatgctttctgtttgggatgtggttagcaatgtggccatttttgtttgagaagattaac
aagaccaagtttgttttctctggcgaaactgtgcccccaaaagagcgtgtcttgttattt
gctaatcacagaaccgaggttgattggatgtacttgtgggatcttgcgttgaggaaaggc
cgtttgcagtgcatcaagtatatccttaagaaaagcttgatgaagttgcctatttttaac
tgggcatttcacattattgaatttattccagtagagcggaagtgggaggttgatgaacca
ttaatccgaagtagactttcggaattaaagaaccctaaggatcccctttggttggcagtt
ttccctgaaggcacggattacacggagaaaaagtgtatcaagagtcaagagtatgcaaaa
gagcacggattgcctattctgaataatgtcctccttcccaagacaaagggttttcattgc
tgtctacaagagttgagggactccatggattctgtttgtgacatcacaatcgcatataag
catcggccaccgacttttatggacaatgtttatggtattgatccttctgaagttcacata
catgttaaaatcattcaagtctctgacatacccacctcagaagatgaagtcgccgattgg
ctgatcgagagatttaaactgaagaacaagcttctgtctgatttctcggcacttggccat
ttccccaacgaaggaactgaagatgatctgtccacactcaagtgcatcgcgaattttgta
gcggtaatcagcacaacgaccgtcctcacgtacctgaccctgttctcgtctgtatggttc
aagattttcgtagcatttagctctgctttccttacttttgcaaccttatactccatacat
ctgccccagctgatatgctccccggaagctggtacccatgccaagaaatcctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349006
Entry
4349006           CDS       T01015                                 
Name
(RefSeq) 1-acyl-sn-glycerol-3-phosphate acyltransferase 1, chloroplastic
  KO
K00655  1-acyl-sn-glycerol-3-phosphate acyltransferase [EC:2.3.1.51]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa00564  Glycerophospholipid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4349006
   00564 Glycerophospholipid metabolism
    4349006
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4349006
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.51  1-acylglycerol-3-phosphate O-acyltransferase
     4349006
Lipid biosynthesis proteins [BR:osa01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   4349006
SSDB
Motif
Pfam: Acyltransferase
Other DBs
NCBI-GeneID: 4349006
NCBI-ProteinID: XP_015612967
UniProt: Q337H3 Q0IWP4
LinkDB
Position
10:18917051..18920355
AA seq 332 aa
MGTLLRPRPLAHAAGAGDATPSTAHAVVVSGGRGRGVECQPHRVRRRPGPQVAVATASWR
RRRETVVRSDFAAGGAATMGDSPQALSDIDVVSRVRGVCFYAVTAVAAIFLFVAMVVVHP
LVLLFDRYRRRAQHYIAKIWATLTISMFYKLDVEGMENLPPNSSPAVYVANHQSFLDIYT
LLTLGRCFKFISKTSIFMFPIIGWAMYLLGVIPLRRMDSRSQLDCLKRCVDLVKKGASVF
FFPEGTRSKDGKLGAFKRGAFSVATKTGAPVIPITLLGTGKLMPSGMEGILNSGSVKLII
HHPIEGNDAEKLCSEARKVIADTLILNGYGVH
NT seq 999 nt   +upstreamnt  +downstreamnt
atggggaccctcctccggccgcgtccgctcgcccacgccgccggcgccggcgacgccacg
ccgtcgaccgcgcacgcggtggtggtgagcggtggccgcggccgtggcgtggagtgccag
ccgcatcgggtgcgccgccgcccgggtccgcaggttgcggtggcgacggcgagctggagg
aggcggagggagaccgtggtgagatcggatttcgccgctggtggtgccgctaccatgggg
gattcgccgcaggcgctctcagacatcgatgtggtttcaagggtcagaggggtttgcttc
tacgcggtgactgcagttgcagcaatctttttgtttgtcgccatggttgtggttcatcca
cttgtgctcctatttgaccgataccggaggagagctcagcactacattgcaaagatttgg
gcaactctgacaatttccatgttctacaagcttgacgtcgagggaatggagaacctgcca
ccgaatagtagccctgctgtctatgttgcgaaccatcagagtttcttggatatctatacc
cttctaactctaggaaggtgtttcaagtttataagcaagacaagtatatttatgttccca
attattggatgggcaatgtatctcttaggagtaattcctttgcggcgtatggacagcagg
agccagctggactgtcttaaacggtgtgtggatttggtgaaaaaaggagcatctgtattt
ttctttccagaggggactagaagcaaagatggaaagctaggtgcatttaagagaggtgca
ttcagtgtggctacaaagaccggtgctcctgtgatacctattactcttctcgggacaggg
aaactgatgccttctggaatggaaggcatccttaattcaggttcagtaaagctcattatt
caccatccaattgaagggaatgatgctgagaaattatgttctgaagcaaggaaggtgata
gctgacactcttattctaaacggttatggagtgcactaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350987
Entry
4350987           CDS       T01015                                 
Name
(RefSeq) 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1
  KO
K13523  lysophosphatidic acid acyltransferase / lysophosphatidylinositol acyltransferase [EC:2.3.1.51 2.3.1.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa00564  Glycerophospholipid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4350987
   00564 Glycerophospholipid metabolism
    4350987
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4350987
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.51  1-acylglycerol-3-phosphate O-acyltransferase
     4350987
    2.3.1.-
     4350987
Lipid biosynthesis proteins [BR:osa01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   4350987
SSDB
Motif
Pfam: Acyltransf_C Acyltransferase
Other DBs
NCBI-GeneID: 4350987
NCBI-ProteinID: XP_015617849
UniProt: Q2R0P3
LinkDB
Position
11:complement(25199842..25206038)
AA seq 374 aa
MAVPLVLVVLPLGLLFLLSGLIINAIQAVLFLSIRPFSKSLYRRINRFLAELLWLQLVWL
VDWWAGVKIQLHADDETYKAMGNEHALVISNHRSDIDWLIGWILAQRSGCLGSTLAVMKK
SSKFLPVIGWSMWFAEYLFLERSWAKDEKTLKWGLQRLKDFPRPFWLALFVEGTRFTPAK
LLAAQEYAVSQGLPAPRNVLIPRTKGFVSAVTIMRDFVPAIYDTTVIIPKDSPQPTMLRI
LKGQSSVVHVRMKRHAMSEMPKSEDDVSKWCKDIFVAKDALLDKHLATGTFDEEIRPIGR
PVKSLLVTLFWSCLLLYGAVKLFLWTQLLSTWKGVGFTGLGLALVTAVMHVFIMFSQSER
SSSAKAARNRVKKD
NT seq 1125 nt   +upstreamnt  +downstreamnt
atggcggtcccactcgtgctcgtcgtgctcccgctcggcctcctcttcctcctctccggc
ctcatcatcaacgccatccaggccgtcctgtttctctcgataaggccgttctcgaagagc
ttgtaccggcggatcaacaggttcttggccgagctgctgtggcttcagctggtctggctt
gtggattggtgggcaggagttaagatacaactgcatgctgatgacgaaacttacaaggca
atggggaatgagcatgcacttgtcatatcaaatcatcggagcgatatcgattggcttatt
gggtggattttggcacagcgctcaggatgccttggaagtacacttgctgttatgaagaaa
tcatcgaaattccttccagttattggctggtccatgtggtttgcagaatacctctttttg
gaaaggagctgggcaaaggatgaaaagacattgaaatggggcctccaaaggttgaaggac
ttccccagaccattttggctagccctttttgttgagggcactcgctttactccagcaaag
cttctagcagctcaggagtatgctgtttcacagggtttgccagcacccagaaatgtattg
attccacgtacaaagggatttgtatcagctgtaactattatgcgggattttgttccagct
atttatgatacaacagtaattattccaaaagattcacctcaaccaacaatgctgcggatt
ttgaaagggcaatcttcagtggtacatgttcgcatgaaacgtcatgcaatgagtgagatg
ccaaagtcagaagacgatgtttcaaaatggtgcaaagacatctttgtagcaaaggatgca
ttactggataagcatttggcgacaggcacttttgatgaggagattagaccaattggccgc
ccagtaaaatcattgctggtgactttgttttggtcatgtctccttttatatggcgccgtc
aagctcttcctatggactcaactcctgtcgacatggaaaggagtcgggtttacgggcctt
gggctcgcactggtgacggcggtcatgcatgtcttcatcatgttctcgcagtcagagcga
tcgagctcagccaaggcggctcggaaccgtgtcaagaaagattga

DBGET integrated database retrieval system