KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327023
Entry
4327023           CDS       T01015                                 
Name
(RefSeq) triacylglycerol lipase SDP1
  KO
K14674  TAG lipase / steryl ester hydrolase / phospholipase A2 / LPA acyltransferase [EC:3.1.1.3 3.1.1.13 3.1.1.4 2.3.1.51]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00100  Steroid biosynthesis
osa00561  Glycerolipid metabolism
osa00564  Glycerophospholipid metabolism
osa00565  Ether lipid metabolism
osa00590  Arachidonic acid metabolism
osa00591  Linoleic acid metabolism
osa00592  alpha-Linolenic acid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00089  Triacylglycerol biosynthesis
osa_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    4327023
   00561 Glycerolipid metabolism
    4327023
   00564 Glycerophospholipid metabolism
    4327023
   00565 Ether lipid metabolism
    4327023
   00590 Arachidonic acid metabolism
    4327023
   00591 Linoleic acid metabolism
    4327023
   00592 alpha-Linolenic acid metabolism
    4327023
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.51  1-acylglycerol-3-phosphate O-acyltransferase
     4327023
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.3  triacylglycerol lipase
     4327023
    3.1.1.4  phospholipase A2
     4327023
    3.1.1.13  sterol esterase
     4327023
SSDB
Motif
Pfam: DUF3336 Patatin
Other DBs
NCBI-GeneID: 4327023
NCBI-ProteinID: XP_015621385
UniProt: Q94DR5
LinkDB
Position
1:complement(32058306..32062910)
AA seq 1044 aa
MDAISSEAPVGVFAIGPSTALGRALALRVLLCGSLGRLRHRLAAALRAALPVAAGWLHPR
DNTRGILLAVCAVALLLRVRGRGGGRAGVRARVQSAYRRKFWRNMMRAALTYEEWAHAAR
MLDRETPRRATDADLYDEELVRNKLRELRHRRQEGSLRDIVFCMRADLLRNLGNMCNSEL
HKGRLQVPKLIKEYIEEVSTQLKMVCNSDSDDLPLEEKLAFMHETRHAFGRTALLLSGGA
SLGCFHVGVVKTLVEHKLLPRIISGSSVGSIMCSIVATRSWPELESFFEEWHSLKFFDQM
GGIFPVVKRILTHGAVHDIRHLQTLLRNLTSNLTFQEAYDMTGRILVVTVCSPRKHEPPR
CLNYLTSPHVLIWSAVTASCAFPGLFEAQELMAKDRFGETVPFHAPFLLGLEERVGATTR
RWRDGSLESDLPMKQLKELFNVNHFIVSQANPHIAPLLRLKEIIRAYGGSFAAKLAELAE
MEVKHRCNQILELGFPLGGIAKLFAQDWEGDVTVVMPATLAQYSKIIQNPSYAELQKAAN
QGRRCTWEKLSAIRANCAIELVLDECVALLNHMRRLKRSAERAAASQGHGPTIRLCPSRR
IPSWNLIARENSSGSLEEEFLISPRTNHHADGGIAGPSNKNHHVQQNVHDGSDSESESID
LNSWTRSGGPLMRTASANKFVSFVQNLEIDTEFRTISSREDRTDVVTPNANFLVSQAIGR
ESVDNSAMPITPDRSLGNSGYDPHDSNVPRSPFGCSTSIMVSEGDLLQPEKIENGILFNV
VKRDTLLTPTGGVELQGTSQEPDVETIQTECLDDASDDDDVGLNAGDEAAIDPRANMSSQ
NTQHQGSSLENINLSSSVDCEAETITSKSKGSSLFDIGMEIRPTILSTESSMYERSSAKI
GLRTVHAEFISNPGAGKGEVDSGAANKEFSYFSQTADTVIFSESCETGQHHEVNVEALTS
YPVSVLEDDRSGGFNLSEIMATTFIAEADAPISRRDEVEQHNGSPVETFLDTETVQAGPC
SSTLEGNNTNNSEEMQVVCTSGTN
NT seq 3135 nt   +upstreamnt  +downstreamnt
atggacgcgatcagcagcgaggcgccggtgggggtgttcgcgatcggcccgtccacggcg
ctgggccgcgcgttggcgctgcgggtgctgctctgcggctccctggggcggctgcgccac
cgcctcgccgcggcgctgcgggccgcgctccccgtggcggcgggctggctgcacccgcgg
gacaacacccgcgggatcctgctcgccgtctgcgccgtcgcgctcctgctgcgggtgcgg
gggcggggcggcgggcgcgccggggtccgggcgcgggtgcagtccgcgtaccggcgcaag
ttctggcggaacatgatgcgcgccgcgctcacctacgaggagtgggcgcacgccgcgcgg
atgctggaccgcgagaccccgcgccgcgccaccgacgccgacctctacgacgaggagctc
gtgcgcaacaagctccgcgagctcaggcaccgccgccaggagggctcgctcagggacatc
gtcttctgcatgcgcgccgacctgctcaggaatctcggcaacatgtgcaactccgagctc
cacaaggggaggctgcaggtgccgaaactcataaaggagtacattgaggaagtatctact
cagctgaaaatggtatgtaattctgattcagacgacttgcctctcgaagagaaacttgca
tttatgcatgagacaagacatgccttcggtagaacagccttgctgctaagcgggggtgct
tctctaggttgtttccatgtgggtgttgtgaaaacattggtagaacataagcttctgcca
aggataatttcaggatctagcgttggttctataatgtgctccatagtagcaacaaggtca
tggccagagctggagagctttttcgaggagtggcattccttgaagttctttgaccagatg
ggcgggatctttcccgtagttaaaaggattttgactcatggagctgttcatgacattaga
catttgcagacgcttttgagaaatcttaccagcaatttgacattccaagaggcctatgac
atgacgggccggattcttgttgtcactgtgtgttctccaaggaagcatgagccacctcga
tgcctgaactatttgacatcacctcatgttctcatctggagtgcagtaactgcttcctgt
gcttttcctggtctttttgaggcccaagagttgatggcaaaagacagatttggagaaaca
gttccttttcatgctcctttcctgttgggcttggaagaaagagttggtgctacaactcgg
cgttggagagatgggagcttggaaagtgatttgccaatgaagcaattgaaggaattattc
aatgtgaatcatttcatagtaagccaagccaatcctcacatagctccactgttgagactc
aaggaaattatcagggcttatggaggcagttttgctgccaagttggctgaacttgctgag
atggaagttaagcataggtgcaaccaaattctcgaacttggatttcctttaggaggaata
gccaagttgtttgctcaagattgggaaggtgatgtcacagttgttatgccagccacgctt
gctcagtattccaagatcatacagaatccatcttacgctgagcttcagaaggctgcaaat
cagggtaggcgatgcacctgggagaagttatcagccattagggcaaattgtgctattgag
ctggtactagatgaatgtgttgccctgttgaaccatatgcgtaggctaaagagaagcgcg
gaaagagcagcagcttcacaaggacatggtcctacaatcagactctgcccatctagaagg
attccatcatggaatctcatagcaagagaaaattcatctggttcccttgaagaagaattc
cttatatctcctcgtacaaaccatcatgcagatggaggaattgctggaccatctaacaaa
aaccatcatgtccaacaaaatgtacatgatggcagtgacagtgaatctgagagtatagac
ttaaactcatggacaagaagtggtggccctcttatgaggacagcctcagccaacaaattc
gtcagttttgttcagaatcttgagattgacacagagttcagaacaatttcatcgagggaa
gacagaactgatgttgtaacaccaaatgctaatttcttggtttctcaggcaattggtaga
gaatctgttgacaacagtgcaatgcctattactcctgataggagcttgggcaattcaggt
tatgatcctcatgatagtaatgtccctagatctccatttggttgttcaacaagtatcatg
gtttctgaaggcgacttactgcaacccgaaaagattgaaaatggtattctgtttaatgtt
gtgaaaagggatactcttctaacacctacaggtggagttgagcttcagggaacatcgcag
gaaccagacgtggaaacaattcagacagagtgccttgatgatgcttcggatgacgacgat
gtgggattaaatgctggtgatgaagcagcaattgaccctagagcaaacatgagcagccaa
aatacacaacaccaggggtcttcactagaaaatataaatctgtcctcttcagtagattgt
gaagctgaaacaattactagtaaatcaaagggttcatctctttttgatattggtatggag
attcgtccaacaatcttgagcacggaaagtagtatgtacgagaggtcttctgcaaaaata
ggactgaggacagtgcatgcagaatttatcagcaatccaggtgctgggaagggagaagtt
gactcaggggctgctaataaagaattttcctatttttctcaaacagcagatactgttata
ttttcagaaagctgtgaaactgggcaacatcatgaagtgaatgtagaagctttaacctca
taccctgtttcagttctggaagatgataggtctggtggcttcaatttgagtgaaataatg
gctacaactttcattgccgaagctgatgctccaatatctagaagagatgaagttgagcag
cataacggatctccagtggaaacattcctggacacagaaacggtacaagctgggccttgc
agttctactttggagggcaacaacaccaacaattccgaggaaatgcaagttgtttgcacc
tcaggaaccaattag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333862
Entry
4333862           CDS       T01015                                 
Name
(RefSeq) phospholipase A2 homolog 3
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00564  Glycerophospholipid metabolism
osa00565  Ether lipid metabolism
osa00590  Arachidonic acid metabolism
osa00591  Linoleic acid metabolism
osa00592  alpha-Linolenic acid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4333862
   00565 Ether lipid metabolism
    4333862
   00590 Arachidonic acid metabolism
    4333862
   00591 Linoleic acid metabolism
    4333862
   00592 alpha-Linolenic acid metabolism
    4333862
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:osa03036]
    4333862
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     4333862
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Centrosome formation proteins
   Centriole proteins
    4333862
SSDB
Motif
Pfam: Phospholip_A2_1 Phospholip_A2_4
Other DBs
NCBI-GeneID: 4333862
NCBI-ProteinID: XP_015628413
UniProt: Q10E50
LinkDB
Position
3:28548292..28549952
AA seq 163 aa
MARGGSFSRLRLRAGVVVAAAAAALLLFAVVAPPAAALNIGLQSAGDGASKAGLCSRTCE
SDHCTTPPLLRYGKYCGILYSGCPGEQPCDELDACCMHHDNCVQAKNDYLSTACNEELLE
CLARLREGSSTFQGNKCMIDEVIDVISLVIEAAVVAGRLLHKP
NT seq 492 nt   +upstreamnt  +downstreamnt
atggcgcgcggcgggagcttctcgcggctgcggctgcgcgcgggggtcgttgtcgccgcc
gccgccgccgccctgctcctcttcgccgtcgtcgcgccgcccgccgcggcgctcaacatc
ggcctccagtccgccggcgacggcgcgagcaaggccgggttgtgcagccgcacgtgcgag
tccgaccactgcacgacgccgccgttgctgcgctacggcaagtactgcggcatcctgtac
agcggctgccccggcgagcagccgtgcgacgagctcgacgcctgctgcatgcaccacgac
aactgcgtccaggccaagaatgactacctgagcacggcgtgcaacgaggagttgctggag
tgcctggcgaggctgcgggagggctcgtcgacgttccaggggaacaagtgcatgatcgac
gaggtcatcgacgtgatctcgctcgtcatcgaggccgccgtcgtcgccggcaggctgctg
cacaagccttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334536
Entry
4334536           CDS       T01015                                 
Name
(RefSeq) triacylglycerol lipase SDP1
  KO
K14674  TAG lipase / steryl ester hydrolase / phospholipase A2 / LPA acyltransferase [EC:3.1.1.3 3.1.1.13 3.1.1.4 2.3.1.51]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00100  Steroid biosynthesis
osa00561  Glycerolipid metabolism
osa00564  Glycerophospholipid metabolism
osa00565  Ether lipid metabolism
osa00590  Arachidonic acid metabolism
osa00591  Linoleic acid metabolism
osa00592  alpha-Linolenic acid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00089  Triacylglycerol biosynthesis
osa_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    4334536
   00561 Glycerolipid metabolism
    4334536
   00564 Glycerophospholipid metabolism
    4334536
   00565 Ether lipid metabolism
    4334536
   00590 Arachidonic acid metabolism
    4334536
   00591 Linoleic acid metabolism
    4334536
   00592 alpha-Linolenic acid metabolism
    4334536
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.51  1-acylglycerol-3-phosphate O-acyltransferase
     4334536
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.3  triacylglycerol lipase
     4334536
    3.1.1.4  phospholipase A2
     4334536
    3.1.1.13  sterol esterase
     4334536
SSDB
Motif
Pfam: DUF3336 Patatin
Other DBs
NCBI-GeneID: 4334536
NCBI-ProteinID: XP_015631080
UniProt: Q0DMF7 Q7XZH2
LinkDB
Position
3:complement(33941623..33946142)
AA seq 820 aa
MDLSGEASLGGFKIGPSTLVGRGVAIRVLLLSSLWRLRERAYAAASRVRGAALPVVAPWL
HLRNTHGILLVVVLFALFLRRLSGARSRAALARRRLQCKKAMRYAASYEEWARAAKVLDK
MSEQVSESDFYDEELIRNRLEELRRRREEGSLRDVVFCMRGDLVRNLGNMCNPELHKGRL
EVPKLIKDYIDEVSAQLKMVCESDTDDLLLEEKLAFVQETRHAFGRTALLLSGGASLGSF
HVGVVKTLVEHKLLPRIVAGSSVGSIICSIVATRTWPEIQSFFVDSLQTLQFFDRIGGIF
AVTKRVMTYGALHDISQMQRLLRDLTGNLTFQEAYDMTGRVLGVTVCSPRKNEPPRCLNY
LTSPHVVIWSAVTASCAFPGLFEAQELMAKNRFGEIVPFHAPFSTDPEQGPGASKRRWRD
GSLEMDLPMMQLKELFNVNHFIVSQTNPHISPLLRLKEIVTTYGGRFAGKLARLAEMEVK
YRCNQILEIGLPLGGLAKLFAQDWEGDVTMVMPATAAQYLKIIQNPTYAELQMAANQGRR
CTWEKISAIRTNCAIELALDESIAVLNHKRRLKRSMERVASASQGYTCSSVIRTPRRVPS
WSCISRENSTGSLSEDCFATTSSSTHQGIQVVATPNVIHNDGSESESETIDLNSWTRSGG
PLMRTSSADMFINFIQNLEIESEFNTGNSSGSTVSKDSCPNNNSGVTAQGTDRSTDTSET
GSCNTGNNIASQPSTSTSIAVSEGELLQPERSTNGILINVVKRKSVFGEHESEAETESYV
DTTNLDTSDCPGDNKDAADSNDLSAAHTDSVTSQHSSADE
NT seq 2463 nt   +upstreamnt  +downstreamnt
atggatttgtccggggaagcaagcctcgggggattcaagatcgggccatcgacgctcgtc
ggccgcggggtagccatccgcgtgctcctcctcagctcgctgtggcgcctgcgcgagcgc
gcctacgccgccgcctcgcgcgtgcgcggcgcggcgcttccggtggtcgcgccctggctc
cacctcaggaacacccatggcatcctcctcgtggttgtcctcttcgcgctgttcctgagg
cggctctctggcgcgcggtcgcgggcggcgctggcgcgccggcggttgcagtgcaagaag
gcgatgaggtacgcggcgagctacgaggagtgggcgcgcgccgccaaggtgctcgacaaa
atgtctgagcaggtcagtgagagcgatttctacgacgaggagctcatcaggaacaggctg
gaggagctccgaaggcggagggaggaagggtcgctccgggatgtggtgttctgcatgcgt
ggtgatcttgtgaggaatttggggaacatgtgcaatcccgagcttcataagggcaggctt
gaggttcctaagcttataaaagattacattgatgaggtttctgcccagctgaaaatggta
tgtgaatctgataccgatgatttgcttttggaagagaaacttgcctttgttcaagagacc
aggcatgcctttgggaggacagcattactcttaagtgggggtgcttcactgggatctttt
catgtaggtgtagtgaaaacactggttgagcacaagcttttgcctcgaatagttgcagga
tctagtgttggttccattatatgttcaattgttgcgacccgaacatggcctgagatccag
agcttctttgtagactcattgcagaccttgcagttctttgataggataggtggaattttt
gcagtaacaaaacgggttatgacttatggtgcactccatgacattagccagatgcaaagg
cttttgagggatctgacaggcaacttaacatttcaagaggcttatgacatgactggccgt
gttcttggcgtcacagtttgctctcctagaaaaaatgagccaccccgctgcctcaactac
ctgacatcaccacatgttgttatttggagtgccgtgactgcctcttgtgcatttcctggg
ctcttcgaagctcaggaattgatggcaaagaatagatttggtgagatagttcccttccac
gcacccttttccacagacccagagcaaggtcctggagcatcaaagcgtcggtggagggat
ggaagtttggagatggatctgcccatgatgcaactcaaagagttgttcaacgtaaatcac
ttcattgtgagccaaactaatcctcacatctctccactcctccgactgaaggagattgtc
acaacctatggaggtcgcttcgctggaaagcttgctcgtctggctgaaatggaggttaag
tacagatgtaaccaaatcctagaaattggcctcccactgggaggactagcgaaattgttt
gctcaggattgggagggtgatgtcaccatggttatgccggcaacagcagcccagtacttg
aagattatacaaaaccctacatatgcggagctgcaaatggctgccaaccaggggcgcagg
tgcacatgggagaagatctctgcgatcagaacaaactgtgctattgaacttgcgttggat
gagtccattgccgttctaaaccataaaagaagactaaagagaagcatggaaagggtagct
tctgcttcccagggatatacatgcagttctgtaatcagaacaccaaggagggtaccatcg
tggagctgcatcagtcgagagaattctacaggatctctctcagaagattgttttgcaacc
actagttcatctactcaccaaggaattcaagttgttgccacaccgaacgttattcataat
gatggaagtgagagtgaatcagaaaccattgacttaaattcttggacccggagtggtgga
cctctaatgaggacttcatcagctgacatgttcatcaatttcattcagaatcttgagata
gagtctgagttcaatacaggtaattcatcaggatctaccgtttctaaagattcatgccca
aacaataattctggagttactgcacaaggtacagatagaagcacagacacatctgaaact
ggttcatgcaatactggcaacaatatagctagtcaaccctctacctctacaagcattgct
gtttctgaaggagaactgctgcaaccagaaaggagtactaacggaattctaattaatgtt
gtcaaaagaaagagtgtgtttggtgagcatgaaagcgaagctgaaaccgaatcatatgtg
gacacaacaaatttggacacttctgactgtcctggagataacaaagatgcagctgactca
aacgatctttcagctgctcatactgattctgtgacttcacaacattcttcagctgatgaa
tag

DBGET integrated database retrieval system