KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327034
Entry
4327034           CDS       T01015                                 
Name
(RefSeq) glycerophosphodiester phosphodiesterase GDPD6
  KO
K01126  glycerophosphoryl diester phosphodiesterase [EC:3.1.4.46]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4327034
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.46  glycerophosphodiester phosphodiesterase
     4327034
SSDB
Motif
Pfam: GDPD CRR7
Other DBs
NCBI-GeneID: 4327034
NCBI-ProteinID: XP_015639363
LinkDB
Position
1:32130567..32139205
AA seq 555 aa
MRPSLRTIYFLLLLLPHVVFSRPLFPLPSKSNGIEKRPLQTFRPYNIAHRGSNGEIPEET
AAAYLRAIEEGADFIETDILASKDGALICFHDVTLDATTDVASRKEFSNRRRTYEVEWFN
ATGWFVVDFTLEELKTLKVNQRYPFRDQQYNGKFSIITFEEFISIALDASRTVGIYPEMK
DPVFINKHVKWDGGKKFEDKFVDTLLKYGYKGQYMSENWLKQPLFIQSFAPTSLVHASKL
TDSPKIFLIDDFSVRTQDTNQSYWDITSDDYLAYISNYVVGLGPWKDTVVPAAKNYTMAP
TDLVARAHAHNLQVHPYTYRNENQFLHLNFHQDPYAEYDFWINSMGVDGLFTDFTGSLHR
YQELVAPHAKDETANSLLVKIAQMISQYEGFWEDFRPHNLSRGRMEAAAAASTGELLTGK
SSAPLPHKRRSRDTTLCCCAHRQQKIAAFAGSRIIFSRHVIQVVVVCAARRRRADIQSET
YVLMEPGEEEEFVSKEELEGRLRGWLERWPGGELPPDLARFDTVDDAVSYLVRSVCELEI
DGEVGSVQWYQVQLE
NT seq 1668 nt   +upstreamnt  +downstreamnt
atgcggccttcgctccgtactatctattttcttcttttgctacttccacatgtggttttt
tctagaccactctttccactaccaagcaagagtaatggaatagagaagagacccttacaa
acttttcgaccatataacattgctcaccgtggctcaaatggggaaattcctgaggaaaca
gctgctgcttacctgagggctattgaagaaggtgcggattttatagaaacggacatcctt
gctagcaaagatggggccttgatctgctttcatgatgtaacactggatgctacaactgac
gttgccagccgcaaggagttttccaatagaagaagaacctacgaggtggaatggttcaac
gctactggctggtttgtagtggacttcacacttgaggaacttaaaacactgaaagtcaat
cagcgatacccattcagagaccaacaatacaatggcaagttttcaattatcacatttgaa
gaattcatttctattgccttggatgcaagcagaactgtcggaatatacccagagatgaaa
gatccagtttttatcaacaagcatgtcaagtgggatggtgggaagaagtttgaggacaaa
tttgtggataccttactgaagtatggatataaaggccaatatatgtcagaaaattggctg
aagcagccgttgtttatacaatcttttgctcctacttcccttgtacatgcatcaaagttg
acagactctcccaagatattcctgattgacgatttctcagtgagaacacaagatacaaac
cagtcatactgggacatcacttctgatgactacctagcatatattagtaactatgttgtt
ggccttggtccatggaaagatacggttgttccagcagccaaaaactatacgatggcaccg
actgatcttgttgcaagagcacatgctcataatcttcaggtacacccgtacacatacagg
aacgagaaccaattcctgcacctcaacttccatcaggacccttatgctgagtatgatttc
tggataaacagcatgggggtcgatggattgttcactgatttcactggatccctgcaccgt
taccaggaactggtagctccacatgcgaaggatgaaactgcaaacagcctcctagtaaaa
attgctcaaatgatctcccaatatgaaggtttctgggaagatttcaggccacacaacttg
agcagaggaaggatggaagcggcggcggctgcctccaccggcgaacttttgacaggcaaa
agttcagcgcctctaccccacaagaggcgatcgcgagacactacgctctgctgctgcgcg
catcgccagcagaaaatcgcagcatttgcaggctctcgcatcattttcagtcgccacgtg
atccaggtggtggtcgtctgcgcggctcggcggaggagggcggacatccagtcggagacg
tacgtgctgatggagccaggggaggaggaggagttcgtgagcaaggaggagctggagggc
aggctgagggggtggctggagcggtggcccggcggcgagctgccgccggacctcgcgagg
ttcgacaccgtcgacgacgccgtgtcgtacctcgtccggtccgtctgcgagctggagatc
gacggcgaggtcggctccgtgcagtggtaccaggttcagctggagtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329468
Entry
4329468           CDS       T01015                                 
Name
(RefSeq) glycerophosphodiester phosphodiesterase GDPD1, chloroplastic isoform X1
  KO
K18696  glycerophosphodiester phosphodiesterase [EC:3.1.4.46]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4329468
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.46  glycerophosphodiester phosphodiesterase
     4329468
SSDB
Motif
Pfam: GDPD
Other DBs
NCBI-GeneID: 4329468
NCBI-ProteinID: XP_015622550
UniProt: B9F080
LinkDB
Position
2:18536993..18540894
AA seq 388 aa
MAQLKAARVADVPMALDVLAAGAPATSAILAEVDAAGARSAAAGGGGGGGGQRFAVIGHR
GKGMNALASPDRRMQEVKENSLRSFNEAARFPVDYVEFDVQVTKDGCPVIFHDNFIFTKE
DGKILDKRVTDLQLEDFLLYGPQNEQGKGGKPLLRKLKDGRIVNWNVQSDDPLCTLQEAF
EKVNPRLGFNIELKFDDNLEYQEEELTCILQAILKVVFEYAKDRPIIFSSFQPDAAQVMR
KLQSTYPVYFLTNGGTEIYADVRRNSLEEAIKLCLASGMQGIVSEARGIFRHPAAVPKIK
EANLSLLTYGTLNNVPEAVYMQHLMGVNGVIVDLVQEITEAVSELITVPEPDLNADNLSN
GAAKDAATPHFSQCEISFLLRLIPELVQ
NT seq 1167 nt   +upstreamnt  +downstreamnt
atggcccagctcaaggccgcgcgcgtcgccgacgtccccatggcgctcgacgtcctcgcc
gccggcgcccccgccacctccgccatcctcgcagaggtggacgcggcgggtgctcggagc
gccgcggcgggcggcggcggcggcggcggggggcagaggttcgcggtgatcgggcaccgc
gggaaggggatgaacgcgctggcgtcgcccgaccggcggatgcaggaggtgaaggagaac
tcgctcaggtcgttcaacgaggccgcccgattccccgtcgactacgtcgagttcgacgtc
caggttaccaaggatgggtgcccagtcatcttccatgataacttcatctttactaaagaa
gatggtaaaattttagataagcgtgtcacagaccttcagttggaagacttcctgctatat
ggcccacaaaatgagcagggaaagggtggaaaacccttgctacggaaactgaaagatggt
cggatagtgaattggaatgtgcagtcagatgaccctctttgcacacttcaagaagctttc
gagaaggtcaatcctagattgggcttcaatattgagctcaaatttgatgacaatcttgaa
taccaggaggaagagctcacttgtatcctccaggccatcctgaaggttgtttttgagtat
gccaaggatcggcctattattttctctagcttccagcctgacgctgcacaggttatgcga
aaattgcaaagcacataccctgtttactttttgactaatggaggcacagaaatctacgct
gacgttaggaggaactcattggaagaggccatcaagctatgcctcgccagcggcatgcaa
ggaatcgtgtcggaggcacgaggaattttcaggcaccccgctgctgtaccaaagatcaaa
gaggctaacctctccctactgacttatggaacactgaacaacgtaccggaggcggtgtac
atgcaacatctgatgggggtgaacggtgtgatcgtcgacctagtgcaggagatcaccgag
gccgtctctgagctcatcaccgtcccggagcctgacctgaacgccgataatttgagcaat
ggggcagcaaaagacgccgcaacgccacatttctcgcagtgtgaaatctcattcttgctg
aggctcatccctgagcttgtgcaataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333407
Entry
4333407           CDS       T01015                                 
Name
(RefSeq) glycerophosphodiester phosphodiesterase GDPD6
  KO
K01126  glycerophosphoryl diester phosphodiesterase [EC:3.1.4.46]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4333407
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.46  glycerophosphodiester phosphodiesterase
     4333407
SSDB
Motif
Pfam: GDPD
Other DBs
NCBI-GeneID: 4333407
NCBI-ProteinID: XP_015627990
UniProt: Q6AUZ6 A3AK86
LinkDB
Position
3:22615885..22619557
AA seq 391 aa
MAAFWLISIIVLVLLSGESNANPAASQQSQLDVNHRKPLQTFRPYNIAHRGSNGEIPEET
TAAYLRAIEEGADFIESDILATKDGHLICFHDVILDATTDIANRTEFANRKRTYEVERQN
VTGWFVVDFTLEELKSLRVKQRYNFRDQQYNGKYQIITFDEYILIALYADRVVGIYPELK
NPIFINEHVKWSDGKKFEDKFVQTLLKYGYKGEYMSEDWLKQPLFIQSFAPSSLIYMSNM
TNSPKIFLIDDTTVRTQDTNQSYYEITSDAYLAFIRKYIVGIGPWKDTIVPPINNYLGPP
TDLVARAHALNLQVHPYTFRNENMFLHFDFHQDPYLEYEYWLGEIGVDGLFTDFTGTLHR
FQECTTPYPKNEKNAEALLQKINYMLKDSGY
NT seq 1176 nt   +upstreamnt  +downstreamnt
atggctgccttctggctcatctctatcattgtccttgtactactttctggagaatccaat
gccaatccagctgcctctcagcagagtcagctggatgtaaaccacaggaagccacttcaa
actttcagaccttacaacattgcccacaggggttccaatggtgaaatacccgaagagacc
acggctgcctacctgagggctattgaagaaggtgcagacttcatagagtctgacatactt
gcaacaaaggacggacatctgatatgtttccacgatgttatattggacgcaacaactgat
atcgccaatcgtacagaatttgccaacaggaagagaacctatgaagttgagagacaaaat
gtgaccggctggtttgttgtggattttactcttgaagaactcaagtcactgagggtgaaa
caacgctacaatttcagggaccaacagtacaatgggaagtaccagattattacatttgat
gagtacatcttgattgcgctttatgccgatagggttgttgggatatacccagagctcaag
aatcccattttcatcaacgagcacgtcaaatggtcagacgggaagaagtttgaggacaag
tttgtccagacactgctgaaatatggttacaaaggcgaatacatgtctgaagattggctt
aaacagccattgttcattcaatccttcgcaccatcgtcactcatttacatgtcaaatatg
acaaactctccaaaaatattcctaatcgacgataccacagttagaactcaagacactaat
cagtcatactacgagataacttcggacgcttaccttgcgttcataaggaagtacatagtt
ggcattggaccatggaaagatacaattgttcctcccataaataattacctaggtccccca
accgatcttgtcgcgcgagcacacgctctgaatcttcaggtgcatccatacactttcaga
aacgagaacatgttcttgcacttcgacttccaccaagacccttatcttgagtacgagtat
tggctcggtgagattggcgtcgacgggcttttcactgatttcactggtaccttgcacagg
ttccaggaatgcacaactccgtatccaaagaatgaaaagaatgcagaggcactcttgcag
aaaattaactacatgctgaaggatagcggatactaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335688
Entry
4335688           CDS       T01015                                 
Name
(RefSeq) glycerophosphodiester phosphodiesterase GDPD2
  KO
K18696  glycerophosphodiester phosphodiesterase [EC:3.1.4.46]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4335688
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.46  glycerophosphodiester phosphodiesterase
     4335688
SSDB
Motif
Pfam: GDPD MipZ
Other DBs
NCBI-GeneID: 4335688
NCBI-ProteinID: XP_015634572
LinkDB
Position
4:19373596..19377009
AA seq 399 aa
MAQPKAASAAAQLSLAASACIAGAEAAAMVGREGAPAMVAAAAAAAMVVIGHRGKGMNAL
GSADPRLREVKENSLRSFHAAARVAGVSYVEFDVQVTKDGYPVIFHDDFIFTEQDGEICG
RRVTDLRLDEFLSYGPQKDQSKAGKPLFRKLNDGRVLRWDVQSDDALCTLQEALDGVDRR
VGFNVELKFDDDVVYREMELTGILQAILKVVFEHAKERPIFFSSFQPDAARIMRKLQDRY
PVYFLTKGGTQVFADERRNSLEAAVKLCVAGSLRGIVSEARAVLRQPSAIGRIKEAGLSL
LTYGQLNNVPKAVYLQQLMGVDGVIVDLVAEIAAAVSEFAAAAAAAVPVPERDSSSSYMD
GGGDVGLLEMTSPAARTTASFSRREDVSFLLRLTPELVQ
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggcgcagcccaaggccgcctccgccgccgcgcagctcagcctcgccgcctccgcctgc
atcgccggagcggaggcggcggcgatggtgggtagggagggggcgccggcgatggtggcg
gcggcggcggcggcggcgatggtggtgatcgggcaccgggggaaggggatgaacgcgctg
gggtcggcggacccgcggctgagggaggtgaaggaaaactcgctccgctccttccacgcc
gccgcccgcgtcgccggcgtctcctacgtcgagttcgacgtccaggtgaccaaggatggg
tacccggtcatcttccacgacgacttcatcttcaccgaacaagacggcgaaatatgcggg
agacgagtgaccgatcttcgcttggacgagttcctctcttatggtccccaaaaggatcaa
agcaaggctgggaagccattgttcaggaagctgaacgacggcagggtgctgagatgggac
gtgcagtcggacgacgcgctctgcacgctgcaggaggcgttggacggcgtcgaccgccgc
gtcgggttcaacgtcgagctcaagttcgacgacgacgtcgtgtaccgggagatggagctc
accggcatccttcaggccattctcaaggtcgtctttgagcatgccaaggagaggccaatc
ttcttctccagcttccagcccgacgccgcgcgaattatgcgcaaactgcaagatagatac
cctgtgtacttcctgacgaaaggagggacgcaggtgttcgccgacgagaggcggaactcg
ctggaggctgccgtgaagctgtgcgtcgccggcagcctgcgggggatcgtgtcggaggcg
cgggcggtgctccggcagccgtcggcgatcggccggatcaaggaggccggcctctccctc
ctcacctacggccagctcaacaacgtgccgaaggcggtgtacttgcagcagctgatgggg
gtggacggcgtgatcgtcgacctggtggcggagatcgccgcggccgtgtccgagttcgcc
gccgccgccgccgcggcggtgccggtgccggagcgtgattcttcttcttcttacatggac
ggtggtggagatgtggggttgctggagatgacgtcgccggcggcgaggacgacggcgagc
ttctctcggcgggaggacgtctcgttcttgctgaggctcacacccgagcttgtgcagtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343833
Entry
4343833           CDS       T01015                                 
Name
(RefSeq) glycerophosphodiester phosphodiesterase GDPD6
  KO
K01126  glycerophosphoryl diester phosphodiesterase [EC:3.1.4.46]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4343833
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.46  glycerophosphodiester phosphodiesterase
     4343833
SSDB
Motif
Pfam: GDPD
Other DBs
NCBI-GeneID: 4343833
NCBI-ProteinID: XP_015646383
LinkDB
Position
7:complement(24628154..24629840)
AA seq 309 aa
MRAIDEGADFIEADVTATKDGHLVCFHDTTLDATTDVADHPEFASRRRTLEVQWTNVTGF
FITDFTLAELKTLRSKQRYAFRDRSYNGGESSRIITFDEFIDTAAGAASRVVGIYPEIKN
PVFVNRQVRWRDGKKFEDKFVAALKRRGYGGRYMSPAWAARPVFIQSFAPTSLVYAAGLT
DSPMVLLVDDTTVRTEDTSQSYDEVTSDEHLDYMREYVVGVGPWKDTVVPPTTDNKLAAP
TDLVARAHARGLQVHPYTYRNENQFLHFNFRQDPYAEYDYWINDVGDLFTDFPASLRRYQ
EWTTAGRKG
NT seq 930 nt   +upstreamnt  +downstreamnt
atgcgcgccatcgacgagggcgccgacttcatcgaggccgacgtgacggcgaccaaggac
ggccacctcgtctgcttccacgacaccaccctcgacgccaccaccgacgtcgccgaccac
cccgagttcgcctcccgccgtcgcaccctcgaggtccagtggaccaacgtcaccggcttc
ttcatcaccgatttcaccctggccgagctcaagacgctgagatccaagcagaggtacgcg
ttccgggacaggtcctacaacggcggcgagtcgtcgcggatcatcacgttcgacgagttc
atcgacaccgcggctggcgcggcgtcgagggtggtgggcatctacccggagatcaagaac
ccggtgttcgtcaaccggcaggtgcggtggcgcgacggcaagaagttcgaggacaagttc
gtggcggcgctcaagcgtcgcggctacggcggccggtacatgtcgccggcgtgggcggcg
cggccggtgttcatccagtcgttcgccccgacgtcgctcgtctacgccgccggcctcacc
gactcccccatggtgctcctcgtcgacgacaccacggtgcgcaccgaggacacgagccag
tcctacgacgaggtgacctcggacgaacacctcgactacatgagggagtacgtcgtcggc
gtcgggccgtggaaggatacggtggtgccgccgacgacggacaacaagctggcggcgccg
acggacctcgtcgcaagggcgcacgccaggggcttgcaggtgcacccctacacgtaccgg
aacgagaaccagttcctgcacttcaacttccggcaggatccgtacgccgagtacgactac
tggatcaacgacgtcggtgacctcttcaccgactttccggcgagcctccgccgctaccag
gagtggaccaccgccgggaggaagggctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346156
Entry
4346156           CDS       T01015                                 
Name
(RefSeq) glycerophosphodiester phosphodiesterase GDPD1, chloroplastic isoform X1
  KO
K18696  glycerophosphodiester phosphodiesterase [EC:3.1.4.46]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4346156
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.46  glycerophosphodiester phosphodiesterase
     4346156
SSDB
Motif
Pfam: GDPD
Other DBs
NCBI-GeneID: 4346156
NCBI-ProteinID: XP_015648569
UniProt: A0A0P0XIP2
LinkDB
Position
8:26751381..26754576
AA seq 422 aa
MALPAATARAAALCRIAACASASSAAAAATGGRRGAEKLPFSLAERGMVVGGHRGMGMNA
VGAPPGARIEAVRERENTLLSFGRAAAHAAVAFVEFDVQVTKDGCPIIFHDDFILTQETD
AVYAKRVTDLLLEEFLSYGPQKNSHEVIYSFFCWLLLCQVHGYECIFEMPFCKLALMLIV
QISKPLLRRTSDGRVVNWSAKDDDSLCTLQEVFERVSPRLGFNIELKFDDDIFYERSQLD
RALQAVLQVVSQYASNRPVFFSTFHPDAARIMRELQSLYPVLFLTEGGTAQHKDSRRNSL
DEAIRVCLEYELHGLVSEVRGVLKNPSAVLRAKESNLALLTYGQLNNVWEAVYIQYLMGV
NGVIVDLVEEISNAVADFSKPVLNQSMLGSGVDLVGAKHQAFSQQQLGFLLWLIPELIQQ
PH
NT seq 1269 nt   +upstreamnt  +downstreamnt
atggcgctcccggcggcgacggcccgcgcggcggcgctgtgccggatcgcggcgtgcgcg
tcggcatcgtcggcggcggcggcggcgaccggggggaggcgcggggcggagaagctgccg
ttctcgctggcggagcgggggatggtggtgggggggcaccgcgggatggggatgaacgcg
gtgggggcgccgccgggggcgcggatcgaggcggtgagggagcgggagaacacgctgctc
tcgttcggccgtgccgccgcgcacgccgccgtcgccttcgtcgagttcgacgtccaggtt
acaaaagatggctgcccaataatcttccatgatgacttcatcctaacacaagaaactgat
gcagtctatgcaaagcgtgttactgatcttctcttggaagaatttctttcatatgggccg
caaaagaattcccatgaggtgatttactcctttttttgttggcttctgctgtgccaagtt
catggttatgaatgcatttttgagatgccattttgtaaacttgcccttatgttgattgtt
cagatctccaagccattgcttagacggaccagcgatggtagagttgttaactggagcgca
aaagatgatgattccctatgcacattgcaagaagtctttgaacgtgtcagtcctcgtcta
ggatttaacattgagctaaagtttgatgatgacatcttctatgaaaggagtcaacttgac
cgtgcgcttcaagctgtattgcaagttgtttctcagtatgcaagcaataggcctgtattt
ttctcaaccttccatcctgatgcggcaaggattatgagggaacttcagagcttatatcct
gtactcttcttaacagaaggaggaacagctcaacacaaagattcaagaaggaactcactt
gatgaagctatccgggtctgcctagagtacgagttgcatggacttgtatcagaggtaaga
ggggttttaaagaatccctctgcagtccttagagcaaaagagtccaaccttgcacttctg
acctatgggcagctcaataatgtgtgggaggctgtgtacatccagtatttgatgggcgta
aatggcgttattgttgatctagtggaggagatctcaaatgctgtggcagatttcagtaaa
ccagtcctcaatcagagcatgctagggagtggtgtcgacttggttggagcaaagcatcag
gccttctcacagcagcagctgggtttcttgctctggcttatacctgaactgatccagcaa
ccacactga

DBGET integrated database retrieval system