KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327039
Entry
4327039           CDS       T01015                                 
Name
(RefSeq) NAD(P)H dehydrogenase (quinone) FQR1
  KO
K03809  NAD(P)H dehydrogenase (quinone) [EC:1.6.5.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00130  Ubiquinone and other terpenoid-quinone biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    4327039
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.2  NAD(P)H dehydrogenase (quinone)
     4327039
SSDB
Motif
Pfam: FMN_red Flavodoxin_2 Flavodoxin_1
Other DBs
NCBI-GeneID: 4327039
NCBI-ProteinID: XP_015621510
UniProt: A2ZYI3 Q8LQN2
LinkDB
Position
1:33264236..33268321
AA seq 203 aa
MAVKVYVVYYSMYGHVAKLAEEIKKGASSIEGVEAKIWQVPETLHEEVLGKMGAPPKPDV
PTITPQELTEADGILFGFPTRFGMMAAQMKAFFDATGGLWSEQSLAGKPAGIFFSTGTQG
GGQETTPLTAITQLTHHGMVFVPVGYTFGAKMFNMGEVQGGSPYGAGTFAADGSRWPTEM
ELEHAFHQGKYFAGIAKKLKGSA
NT seq 612 nt   +upstreamnt  +downstreamnt
atggcggtgaaggtctatgtcgtgtactactctatgtatggacatgttgctaaactagct
gaagagatcaagaagggtgcttcatctattgaaggtgttgaggctaaaatatggcaggtt
cctgaaactctccatgaggaagtacttggaaagatgggcgcgcctcctaagccagatgtg
ccaacgatcacaccacaagaacttactgaggctgatggaatcctgtttgggttccctaca
aggtttggcatgatggctgcgcagatgaaagcattctttgatgcaaccggtggcctgtgg
agtgagcagagccttgcaggcaagcccgccggcatcttcttcagcactggtacccagggc
ggtggtcaggagactacaccgttgacagcaataactcagttgactcaccacggcatggtg
ttcgtcccggtcgggtacaccttcggtgccaagatgtttaacatgggagaagttcagggg
ggcagcccgtacggcgccggcacctttgccgccgacggctcgaggtggccgacggaaatg
gagctggagcacgccttccaccaggggaagtacttcgcaggcatcgcgaagaagctcaag
gggtccgcttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334108
Entry
4334108           CDS       T01015                                 
Name
(RefSeq) probable NAD(P)H dehydrogenase (quinone) FQR1-like 1
  KO
K03809  NAD(P)H dehydrogenase (quinone) [EC:1.6.5.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00130  Ubiquinone and other terpenoid-quinone biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    4334108
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.2  NAD(P)H dehydrogenase (quinone)
     4334108
SSDB
Motif
Pfam: FMN_red Flavodoxin_2
Other DBs
NCBI-GeneID: 4334108
NCBI-ProteinID: XP_015630590
UniProt: A0A5S6RBL1
LinkDB
Position
3:complement(30807583..30808719)
AA seq 252 aa
MGKGGGCIPSKRHRAAAAAAAPASHSHQRERTSIPAPAAAPRPVRIYVVFYSMYGHVRLL
ARAVARGVGSVPGARAILFRVPETLPPAVLARMEADDGGGGGDGEDVIPVVDPDGLPDAD
GFLFGFPARFGAMPAQMQAFFDSTVPLCRHQRLAGKPAGLFVSTGTQAGGQETTAWTAIT
QLAHHGMLFVPIGYTFGEGMLEMGELRGGSPYGAGVFSGDGSRPPSELELALAEHHGKYM
ATLVKKMVHGAS
NT seq 759 nt   +upstreamnt  +downstreamnt
atgggcaagggcggcggctgcatcccgagcaagaggcaccgcgccgccgcggcggcggca
gcgccagcgtcgcactcgcaccagcgcgagaggacctcgatcccggcgccggcggcggcg
ccgcggccggtgcgcatctacgtcgtgttctactccatgtacgggcacgtccggctcctg
gcgcgggcggtggcgcgcggggtgggctccgtcccgggcgcgcgggcgatcctcttccgc
gtcccggagacgctgccccccgccgtgctcgcgcggatggaggccgacgacggcggcggc
ggcggcgacggcgaggacgtcatccccgtcgtggaccccgacgggctccccgacgccgac
gggttcctcttcggcttccctgccaggttcggcgccatgcctgcgcagatgcaggccttc
ttcgactccaccgtgccgctctgccgccaccagcgcctcgccggcaagccagccggcctc
ttcgtcagcaccggcacccaggccggcggccaagaaaccaccgcctggacggcgatcacg
cagctggcgcaccacgggatgctgttcgtgccgatcgggtacaccttcggggaggggatg
ttggagatgggcgagctccgcggcgggtcgccgtacggcgcgggcgtcttctccggcgac
ggctccaggccgccgtccgagctcgagctggccctcgccgagcaccacggcaagtacatg
gccacacttgtcaagaaaatggtgcacggtgcctcgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339236
Entry
4339236           CDS       T01015                                 
Name
(RefSeq) NAD(P)H dehydrogenase (quinone) FQR1
  KO
K03809  NAD(P)H dehydrogenase (quinone) [EC:1.6.5.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00130  Ubiquinone and other terpenoid-quinone biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    4339236
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.2  NAD(P)H dehydrogenase (quinone)
     4339236
SSDB
Motif
Pfam: FMN_red Flavodoxin_2 Flavodoxin_1 Flavodoxin_5 IcmF-related_N
Other DBs
NCBI-GeneID: 4339236
NCBI-ProteinID: XP_015637559
UniProt: Q0DGZ0 Q60EJ3
LinkDB
Position
5:complement(24669658..24674847)
AA seq 205 aa
MAVKVYVVYYSMYGHVAKLAEEIKKGASSVEGVEVKIWQVPETLSEEVLGKMGAPPRSDA
PVIAPQELAEADGVLFGFPTRFGMMAAQMKAFFDATGGLWREQSLAGKPAGVFFSTGTQG
GGQETTPLTAVTQLAHHGMVFVPVGYTFGAKMFDMAAVHGGSPYGAGTFAGDGSRWPSEA
ELEHAFHQGKYFAGIAKKLKGASSA
NT seq 618 nt   +upstreamnt  +downstreamnt
atggcggtcaaggtctacgtcgtgtattactctatgtatggtcatgtcgccaaactagct
gaggagatcaagaaaggtgcttcatctgtcgaaggcgtggaagttaaaatatggcaggtc
cctgaaaccctctcagaggaggtgctgggcaagatgggcgcgccgccgaggagcgacgcg
ccggtgatcgcgccgcaggagctcgcggaggccgacggcgtcctgttcgggttcccgacg
aggttcggcatgatggcggcgcagatgaaggcgttcttcgacgccaccggcggcctgtgg
cgcgagcagagcctcgccggcaagcccgcgggcgtcttcttcagcaccggcacccagggc
ggcggccaggagacgacgccgctcacggcggtgacgcagctggcgcaccacggcatggtg
ttcgtcccggtcggctacacgttcggcgccaagatgttcgacatggcggcggtgcacggc
ggcagcccgtacggcgccggcacgttcgccggcgacgggtcgaggtggccgtcggaggcg
gagctggagcacgccttccaccagggcaagtacttcgctggcatcgccaagaagctcaag
ggcgcctcctccgcctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344633
Entry
4344633           CDS       T01015                                 
Name
(RefSeq) probable NAD(P)H dehydrogenase (quinone) FQR1-like 1
  KO
K03809  NAD(P)H dehydrogenase (quinone) [EC:1.6.5.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00130  Ubiquinone and other terpenoid-quinone biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    4344633
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.2  NAD(P)H dehydrogenase (quinone)
     4344633
SSDB
Motif
Pfam: FMN_red Flavodoxin_2 Flavodoxin_1 Flavodoxin_5
Other DBs
NCBI-GeneID: 4344633
NCBI-ProteinID: XP_015650752
UniProt: B9FZ00 Q6ZKI0
LinkDB
Position
8:complement(2182767..2184840)
AA seq 203 aa
MAAKIYIVYYSMYGHVAKLAEEIEKGASSVEGVEVKLWQVPETLSDDVLTKMGAPSKKDV
PIITPAELAEADGVIFGFPTRFGMMAAQFKAFMDATGGLWRTQQLAGKPAGIFYSTGSQG
GGQETTPLTAITQLVHHGMIFVPVGYTFGAGMFEMEQVKGGSPYGSGTFAGDGSRVATEL
ELQQAFHQGKYFAGIAKKLKGSA
NT seq 612 nt   +upstreamnt  +downstreamnt
atggccgccaagatctacatagtgtactactccatgtatggccatgttgcaaagctagca
gaggagatcgagaaaggtgcttcttcagttgaaggagttgaggtcaagctatggcaggtc
ccagagactctttctgatgatgtgctcaccaagatgggtgctccttcaaagaaagatgtt
cccataatcacacccgcagagcttgccgaggctgatggtgtcatctttgggttcccaact
agatttggaatgatggctgctcaattcaaagcattcatggatgctaccggtgggctgtgg
aggacacagcagctcgcaggcaagcccgcgggaattttctactctactggttcccagggt
ggtggccaagaaactactccgttgacagcaattactcagctagtgcatcatggcatgatc
tttgttccagtagggtacacctttggtgctgggatgtttgagatggagcaagtgaagggc
ggaagcccgtacgggtctggcacattcgctggtgatggatcaagggttgccactgagctt
gagctgcaacaagccttccaccaagggaagtactttgctggaattgcgaagaaactcaag
ggttccgcatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348705
Entry
4348705           CDS       T01015                                 
Name
(RefSeq) probable NAD(P)H dehydrogenase (quinone) FQR1-like 2
  KO
K03809  NAD(P)H dehydrogenase (quinone) [EC:1.6.5.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00130  Ubiquinone and other terpenoid-quinone biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    4348705
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.2  NAD(P)H dehydrogenase (quinone)
     4348705
SSDB
Motif
Pfam: FMN_red Flavodoxin_2 Flavodoxin_1 Flavodoxin_5
Other DBs
NCBI-GeneID: 4348705
NCBI-ProteinID: XP_015615061
UniProt: A0A0P0XV01
LinkDB
Position
10:15601042..15604282
AA seq 250 aa
MGKGGGCVPSKKRQPPASTVAGAPSSSSAPRDAPEAEASGEAAGGRRRLRLYIVFYSMYG
HVEALARRAAAGVAAVDGVEAVLRRVPETLPPGVLEKMQAPAKDPAVPVIAAAADLEEAD
GVLFGFPTRYGAMAAQMKAFFDSTGSLWEKQKLAGKPAGFFVSTGTQGGGQETTAWTAIT
QIVHHGMLFVPIGYTFGSGMFKMDEIRGGSPYGAGVFAGDGSRQPSETELALAEHQGKYM
ASIVKKLAQA
NT seq 753 nt   +upstreamnt  +downstreamnt
atggggaagggcggcggctgcgtccccagcaagaagcggcagccgccggccagcaccgtc
gccggcgcgccgtcgtcgtcgtcggcgccgcgcgacgcccccgaggcggaggcgtcgggg
gaggcggccggggggcggcggaggctgcggctgtacatcgtgttctactcgatgtacggg
cacgtggaggcgctggcgcggcgggcggcggcgggcgtcgcggcggtggacggggtggag
gcggtgctgcggcgcgtccccgagacgctcccgccgggcgtgctggagaagatgcaggcg
ccggccaaggaccccgccgtcccggtcatcgcggcggcggcggacctggaggaggccgac
ggggtgctgttcgggttcccgacgaggtacggcgccatggccgcgcagatgaaggcgttc
ttcgactccaccggctccctctgggagaagcagaagctcgccggaaagcccgccgggttc
ttcgtcagcaccggcacgcagggaggcggccaggagaccaccgcttggacggcaatcacc
cagatagtgcaccatggaatgctctttgtcccgattggctacaccttcgggtcaggcatg
ttcaagatggatgagatcagaggaggcagcccctatggcgctggcgtcttcgctggtgat
ggcagcagacagcccagcgagacggagctcgccctagccgagcaccagggcaagtacatg
gcctccatagtgaagaagcttgcccaggcttga

DBGET integrated database retrieval system