KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327055
Entry
4327055           CDS       T01015                                 
Name
(RefSeq) diacylglycerol kinase 5 isoform X1
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa00564  Glycerophospholipid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4327055
   00564 Glycerophospholipid metabolism
    4327055
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    4327055
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     4327055
SSDB
Motif
Pfam: DAGK_acc DAGK_cat DUF6296 NAD_kinase
Other DBs
NCBI-GeneID: 4327055
NCBI-ProteinID: XP_015621000
LinkDB
Position
1:complement(33186604..33192973)
AA seq 494 aa
MLQAQDSMKNNLVKNNMLKEFYIPTYIFVPESPVEKVSQIPSCPVIVFINTKSGGQLGHD
LIVTYRKLLNNSQVFDLLEEAPDKVLHKLYGNMERLMRDGDTVAAEIHRRLRLIVAGGDG
TAGWLLGVVSDLKLVHPPPVATVPLGTGNNLPYSFGWGKRNPGTDEKSVLSFLQSVRQAK
EMKIDSWHIVMKMESPKSSTCDPIAPLDLPHSLHAFHRVPNNPQDKEYSCTFRGGFWNYF
SMGMDAQVSYAFHSERKLHPEKFKNQLSNQKTYLKLACTQGWFCASLCHPMSRNIAHLSK
VKIMKKSGKWETLEIPQSIRSIVCLNLPSFSGGLNPWGTPSERKQRKRDLVMPPLVDDGL
LEIVGFKDAWHGLVLLSPKGHGTRLAQAHRVQFKFHKGATDHAYMRLDGEPWNQPLPKDD
GKVLVEISHAGQVKMLATKNCIAKGIHEALSMSTVHPESSSSSDDTDDDDDFAEERKNFG
AALSFRYMDDVTKE
NT seq 1485 nt   +upstreamnt  +downstreamnt
atgttgcaggcgcaagattcaatgaagaacaaccttgtgaaaaacaacatgctgaaagag
ttctacatcccaacttatatattcgtgccagagtctccagtagagaaggtttctcaaata
cctagttgtccagtgattgtttttatcaacaccaaaagtggtggccagctgggacatgat
ttaattgtcacgtaccgtaagctgctcaacaattctcaggtgtttgatctgcttgaggaa
gctccagataaggtcttgcacaaactgtatggaaacatggaaaggctaatgcgtgatggg
gatactgttgctgctgaaattcacagaagattgaggctaatagttgctggaggtgatggt
actgcaggttggttgcttggagttgtttctgatcttaagctagtacatccaccacctgtt
gctacagttcctctgggaactggaaataacttgccatattcttttggatgggggaagaga
aatcctggaacagatgaaaagtcagttctatcgtttctacagtcagtaagacaagcgaaa
gagatgaaaattgatagttggcacattgtcatgaaaatggaaagcccaaaaagttctact
tgtgatccaattgctcctttggatttgcctcattcgctgcacgcgtttcaccgtgtgcca
aacaatccacaagataaggaatattcttgcacgtttcgtgggggattctggaattacttc
agtatgggaatggatgctcaggtgtcatatgcctttcattctgagaggaaattgcatcca
gaaaaattcaaaaaccagttgtctaatcagaaaacatatttgaagctggcatgcacgcaa
ggatggttctgtgcatccctatgtcatccaatgtcacggaacattgcgcacctttcaaaa
gtaaagataatgaagaaatctggaaaatgggaaacattggaaattccacagagtatccgg
tccattgtttgtctgaatttacccagcttctccggtggactgaatccatggggaacacca
agtgagagaaaacaaagaaaaagggatttagtaatgcctccacttgtggatgatggtctt
ctggagattgtgggttttaaagatgcttggcatggacttgtgttgctatctccaaaaggc
catggcactcgtcttgctcaggctcatcgcgtccaattcaaattccacaagggtgcaacc
gaccatgcttacatgagacttgatggggaaccctggaatcagcctcttccgaaggatgac
ggcaaggtcttggtggagatctcacatgccggccaggtgaagatgcttgctaccaaaaac
tgcattgctaaaggcatccatgaggcactgtctatgtcaacggttcatccagagtccagc
tcctccagtgacgatacggatgacgatgatgatttcgcggaggagaggaagaactttggt
gctgcattgtcgtttcggtacatggatgatgtgaccaaagagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330961
Entry
4330961           CDS       T01015                                 
Name
(RefSeq) diacylglycerol kinase 7
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa00564  Glycerophospholipid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4330961
   00564 Glycerophospholipid metabolism
    4330961
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    4330961
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     4330961
SSDB
Motif
Pfam: DAGK_acc DAGK_cat
Other DBs
NCBI-GeneID: 4330961
NCBI-ProteinID: XP_015626235
UniProt: A0A0P0VQI3 Q6K4P5
LinkDB
Position
2:complement(33474279..33484115)
AA seq 488 aa
MERAEETPRAPSTAPSARVSIWESVRACGVWGKEVDKAELRRQVVMPLYARRAVAAAVKA
KDEAVGVAAAAERGEEGEVEVEVEAAVTPVVVFVNSRSGGRHGPELKVRLHELISEEQVF
DLSVVKPSDFINYGLGCLEKLAEQGDNCAETIRKKLRIMVAGGDGTVGWVLGCLTDLYRL
KREPVPPTGIIPLGTGNDLARSFGWGGSFPFGWRSAVKRYLSKAATAPTCSLDSWQAVVM
MPDGEIKELPYALKKTEPADCLELCQENGTELPEKASCYKGVFYNYLSIGMDAQVAYGFH
HLRDEKPYLAQGPVANKLIYAGYSCTQGWFCTPCTASPQLRGLKNILRLYIKKVNCSEWE
QVTMPSSVRSLVVLNLYNYGSGRHPWGDLKPDYLEKKGFVEAHSDDGLLEIFGLKEGWHA
SFVMAELIKAKHIAQAAAIKFEMRGGQWNRAYVQMDGEPWKQPLLQEQSTIIEINKVPYP
SLMINGEQ
NT seq 1467 nt   +upstreamnt  +downstreamnt
atggagcgagcggaggagacgccgagggcgccgtcgacggcgccgtcggcgagggtgtcg
atctgggagtcggtgcgcgcgtgcggggtgtgggggaaggaggtggacaaggccgagctg
cggaggcaggtcgtcatgccgctgtacgcgcggcgtgcggtcgcggccgccgtgaaggcc
aaggacgaggccgtcggcgtggcggcggcggcggagaggggcgaggagggggaggtggag
gtggaggtggaggcggccgtgacgccggtggtggtgttcgtcaactcgcggagcggcggt
aggcacgggcccgagctcaaggtgcggctccacgagctcatcagcgaggagcaggtcttt
gatctctctgtcgtgaagccttctgatttcattaactacgggttgggttgtttggagaaa
ttggccgaacaaggtgacaattgtgcggagaccattcgaaaaaaattgaggattatggtt
gctggtggtgatggcacagttggttgggtacttggctgtctcacagatctttataggttg
aaaagagaaccagttccacccacaggtatcatcccacttggtacaggaaatgatcttgcc
agatcatttggatggggtggctcttttccctttggttggcgttcagctgtgaagcgttat
ctcagcaaggcagctacagctcccacctgcagtcttgacagttggcaagctgtagttatg
atgccagatggagagataaaagagttgccatatgcacttaagaaaacggaacctgcagac
tgcttggaactttgccaggagaatggcactgagttacctgagaaagcttcttgctataaa
ggagtattctacaactaccttagcattgggatggatgcccaagttgcttatggcttccac
catcttcgtgatgaaaagccatatcttgctcaagggcctgttgcaaataagttgatatat
gctggttatagctgcacacaggggtggttctgcacaccttgtacagcaagccctcagtta
agggggcttaagaacattttgcgactttacattaaaaaagtcaattgttctgaatgggag
caagttacaatgccttcaagtgttagatccctggtggtcttaaatttatacaactacggc
agtggaaggcatccatggggtgatcttaaacctgattaccttgaaaagaaaggttttgtc
gaagctcattccgatgatggattgcttgaaatattcggtctgaaagaaggttggcatgct
tcattcgttatggctgagctaattaaagcaaagcacattgctcaggctgcagccatcaag
tttgaaatgaggggtggccaatggaatcgtgcgtatgttcagatggatggagagccatgg
aaacaaccactcctacaggagcagtcaaccattatcgagataaacaaagttccttaccct
tctctgatgataaatggggagcaatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337126
Entry
4337126           CDS       T01015                                 
Name
(RefSeq) diacylglycerol kinase 5 isoform X1
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa00564  Glycerophospholipid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4337126
   00564 Glycerophospholipid metabolism
    4337126
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    4337126
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     4337126
SSDB
Motif
Pfam: DAGK_acc DAGK_cat NAD_kinase Arrestin_C
Other DBs
NCBI-GeneID: 4337126
NCBI-ProteinID: XP_015633854
LinkDB
Position
4:32286666..32291486
AA seq 503 aa
MFCRMDGHTNGTNGSCSKPCEPLTDYCIPDYILNPDSEQVLVDQAPCCPVVVFINSRSGG
QLGSSLIKTYRELLNKAQVFDLSEEAPEKVLHRLYCNFEKLKSNGDPIAFQIQSNLRLIV
AGGDGTASWLLGVVSDLKLSHPPPIATVPLGTGNNLPFSFGWGKKNPTTDQEAVKSFLGQ
VKKAREMNIDSWHIIMRMRAPQEGPCEPIAPLELPHSLHAFHRVSGSDSLNMEGYHTYRG
GFWNYFSMGMDAQVSYEFHSERKRNPEKFKNQLTNQSTYAKLGLKQGWFAASLTHPSSRN
IAQLAKVRIMKRPGGQWEELKIPRSIRSIVCLNLPSFSGGLNPWGTPGTRKVQDRDLTAP
FVDDGLIEVVGFRDAWHGLVLLAPNGHGTRLAQAHRIRFEFHKGAAEHTFMRIDGEPWKQ
PLPKDDDTVVVEISHLRQVTMLASDPCKSKSVNDPSSPMCCSNHDDDERNSLEDEDEWEE
GRKKFGAADTFKFPDEVDVAHLS
NT seq 1512 nt   +upstreamnt  +downstreamnt
atgttttgcaggatggatggacatacaaatggcactaatggttcctgctctaagccatgc
gagccattaacagactactgcatccctgattacattctgaatcctgactctgaacaagtc
ctcgttgatcaggcaccatgttgccctgtagtagtattcatcaactctagaagtggcggc
caactcggaagcagtttgatcaaaacgtatcgtgagcttctcaataaagcgcaggttttt
gatttatcagaagaggctcctgaaaaggtgcttcacagattgtattgcaactttgagaag
ctcaagtctaatggcgaccctattgcttttcaaattcagagcaacctaagactaattgtt
gctggtggtgatggcacagcaagttggctgcttggtgtagttagtgaccttaagctctct
cacccacctcctattgcaactgtgcctctgggaactggaaacaaccttccattctcattt
ggatgggggaagaagaacccaaccactgaccaagaggcggtgaaatcatttcttggacaa
gttaaaaaagcaagagaaatgaatattgatagttggcatatcatcatgaggatgcgagct
ccacaggaaggtccatgtgaacctattgctccgttagagctgcctcactcattgcatgca
ttccaccgtgtatcaggaagcgattcacttaatatggagggctaccacacataccgtgga
ggattttggaattactttagtatggggatggatgcacaagtgtcttacgaatttcactct
gagaggaagagaaatcccgagaagttcaagaaccagctaacaaatcagagtacatatgct
aagcttggacttaaacaaggatggtttgctgcttcactaactcacccatcctcgaggaac
attgctcaacttgcaaaggtgcggatcatgaaaagacctggtggccaatgggaagagctt
aagattcctcgcagcattcgatcaatcgtctgtctgaatctgccaagtttttctggagga
ctgaatccttggggaacacctggcaccaggaaagtacaagatagagacctgactgcacca
tttgtcgacgacggccttatcgaggttgtcggctttcgcgatgcctggcacggtcttgtc
ttgcttgcccctaatggccatggaactcgtctagcacaggcccatagaatccggttcgag
ttccacaaaggagcagccgagcacacgttcatgaggatcgatggggagccatggaagcag
cctcttcccaaggacgatgacaccgtggtcgtcgagatctctcacctccgtcaggtcacc
atgctcgccagcgacccgtgcaagtcgaagagcgtcaacgacccctcgtcgccgatgtgc
tgtagcaaccacgacgacgacgagcgcaacagcttggaggacgaagatgagtgggaggag
gggaggaagaagtttggtgcagctgatacgttcaagttccctgatgaggttgatgttgct
caccttagctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344812
Entry
4344812           CDS       T01015                                 
Name
(RefSeq) diacylglycerol kinase 5
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa00564  Glycerophospholipid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4344812
   00564 Glycerophospholipid metabolism
    4344812
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    4344812
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     4344812
SSDB
Motif
Pfam: DAGK_acc DAGK_cat NAD_kinase
Other DBs
NCBI-GeneID: 4344812
NCBI-ProteinID: XP_015648118
UniProt: Q0J7M1 A0A0P0XCH7
LinkDB
Position
8:complement(4599736..4604722)
AA seq 502 aa
MEGEMDTVVGSSSKPCGPLTDYRIPDYILRPDAQRVLLDHAPPCPVLVFINSGSGGQLGS
SLIKTYRELLGEAQVFDVSEEAPDKVLHRLNVNLEKLKMDGDILAVQIWRTLRIIVAGGD
GTASWLLGVVSDLKLSHPPPIATVPLGTGNNLPFSFGWGKKNPCTDQESVKSFLGLVRHA
KEMKIDSWHIMLRMRATKEGPCDPIAPLELPHSLHAFHRVSSSDSLNMEGYHTFRGGFWN
YFSMGMDAEISYGFHSERKKNPEKFKNQLTNQGTYAKVGLKQGWFCASLSHPSSRNIAQL
ASVKIMKRAGSHWQELNIHHSIRSIVCLNLPSFSGGLNPWGTPGTRKVEERELTAPFVDD
RLIEVVGFRDAWHGLVLLAPNGHGTRLAQAQRIRFEFHKGAAEHTFMRIDGEPWKQPLPK
DDDTVVVEISHLGQVTMLANEPCKSKSVHDDQSSHAQHSGHGNNDDDKDSMEDEDEWEDG
RRKFGAADTFKIPDEVDIAHLS
NT seq 1509 nt   +upstreamnt  +downstreamnt
atggaaggggagatggatactgtggtgggttcatcatccaagccatgcgggccgctgacg
gattaccgcattccggattacatcctgaggccggatgcgcagcgggtgcttcttgatcat
gcgcccccgtgccccgtgctggtgttcatcaattctggatctggtggtcagctcgggagc
agcctgatcaaaacctaccgtgaacttctcggtgaagcgcaggttttcgatgtctccgaa
gaggctccggataaagtgttgcaccgtttgaatgtcaaccttgagaagctcaagatggat
ggagacattcttgctgttcaaatttggagaactctcagaataattgttgcaggtggcgat
ggtacggcaagctggctgcttggggtagtcagtgatctcaagctttcacaccctcctcca
attgctactgtgcctctgggaaccggaaacaaccttccattttcatttggatggggaaag
aagaatccttgtactgaccaagagtcagtaaaatcattccttgggctagtgaggcatgca
aaagagatgaaaattgatagctggcatatcatgttgaggatgcgagctacaaaggaaggt
ccatgtgatccaatcgcccccttagagttgcctcattcattacatgcatttcaccgtgtg
tcaagtagtgattccctcaatatggaaggttaccacacattccgtggaggattttggaat
tactttagtatgggtatggatgcagaaatttcttacggatttcattctgaaaggaagaaa
aatccagagaaattcaaaaaccagctgacaaatcagggtacatatgctaaggttggactt
aaacaaggatggttttgtgcttctttaagtcatccatcttcaaggaatattgctcaactt
gcaagtgtgaaaatcatgaaaagagccggtagccactggcaagaacttaacattcaccac
agcattcgatcaatcgtctgtctcaacctgcctagtttctctggaggtctgaatccttgg
ggcacacctggcacaaggaaagtagaagagagggagctgacggcaccttttgtcgatgat
agacttattgaggttgttggattccgtgatgcctggcacggacttgtcttgctggcccca
aatggacatggtacccgccttgcgcaggcccaaaggatccgtttcgagttccacaaaggc
gcagcagagcacaccttcatgaggatcgatggggagccatggaagcagcccctcccaaaa
gatgacgacaccgttgttgtggagatctcccaccttggtcaggtcaccatgcttgccaac
gagccctgcaagtcgaagagcgtccatgacgaccaatcctcccacgcacaacacagcggc
catggcaacaacgacgacgacaaggacagcatggaggacgaagatgagtgggaggatggc
aggaggaagtttggtgccgcagatacattcaagatccctgacgaggttgacattgctcac
ctcagctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345076
Entry
4345076           CDS       T01015                                 
Name
(RefSeq) diacylglycerol kinase 4
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa00564  Glycerophospholipid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4345076
   00564 Glycerophospholipid metabolism
    4345076
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    4345076
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     4345076
SSDB
Motif
Pfam: DAGK_acc DAGK_cat
Other DBs
NCBI-GeneID: 4345076
NCBI-ProteinID: XP_015650292
LinkDB
Position
8:complement(9127976..9136933)
AA seq 532 aa
MSSSASEQPRGDQVWSSSSPPRSSTPPPQPLVGGLIESLSFRSCGFGRAAVSAFEKEDLR
ARAALPQRLRAAVHAALRAKDPSAGAFAYVAGNAAARGGRGGGGSGGGREVSAANPWFEV
AHDDAPESPLVAFVNPRSGGRLGPVLKTRLQELIGEDQVFDLTVVKPSDFVQYVLGCLEQ
LADAGDHSAKSIRHNLRVMVAGGDGTVGWVLGCLGDLYVQNREPIPPVAVIPLGTGNDLS
RSFGWGASFPFGWKAAAKRSLYKAIFGSVSCLDSWHIVVSMPERGDEEEELDFPHSLRNL
GECTFYDDGTAEGELPETVSCFDGVFYNYFSIGMDAQVAYGFHHLRDEKPFLASGPLSNK
LIYAGYTCKQGWFFTQCVSDPELRGLTNIIRLSIKKLDSSEWENIPVPSSVRAIVALNLH
NYASGRNPWGNLKPEYLEKRGFVEAQSDDGLLEIFGLKQGWHASLVMVELISAKHIAQAA
AIRLEIKGGQWRDAYMQMDGEPWKQPLDHEYSTFVDIKKVPYPSLIINGGDR
NT seq 1599 nt   +upstreamnt  +downstreamnt
atgtcgtcgtcggcgtcggagcagccgcgcggggaccaggtgtggtcgtcgtcgtcgccg
ccgcggtcgtcgacgcctcccccgcagccgctcgtggggggcctgatcgagtcgctctcg
ttccggagctgcgggttcggccgcgccgccgtctccgcgttcgagaaggaggacctccgc
gcccgcgccgcgctgccgcagcggctccgggccgcggtccacgcggcgctgcgtgccaag
gacccctccgcgggggcgttcgcctacgtcgccggcaacgcggctgcccggggtgggcga
ggaggcggcggcagcggcggcggccgcgaggtgtcggcggccaacccgtggttcgaggtc
gcccacgacgacgcccccgagtcccccctcgtcgcgttcgtcaacccccgcagcggcggc
cgcctcggccccgtcctcaaaacccgcctccaggagctcatcggcgaagaccaggttttt
gatcttactgttgtgaagccttctgactttgtgcaatatgttttgggttgcttggaacaa
cttgctgacgctggtgatcacagtgcaaagtccattcgccataatctaagagtcatggtt
gcaggaggtgatggtacagtaggttgggtgttgggatgtttaggagacctttatgttcag
aacagggaaccaattcctccagttgctgttataccacttgggacaggaaatgatctttcc
aggagttttggctggggtgcttcatttcctttcggatggaaagcagctgctaaacgatct
ctgtacaaagctatttttggttcagtttcttgtttagacagttggcatattgttgtttct
atgccagaacgaggagatgaagaggaagaactggattttcctcactcccttaggaatctt
ggagagtgtaccttttatgatgacggcactgctgaaggggagttgcctgaaacagtttct
tgctttgatggcgtattctataattacttcagcataggtatggatgctcaagtggcgtat
ggatttcaccatctacgggatgaaaagccattccttgctagtggtcctttatctaataag
ttaatttacgcagggtatacctgcaagcagggatggttttttacacaatgtgtcagcgac
cctgaactgaggggattgacgaacattattcgtttatcaataaagaagttggacagctct
gagtgggagaacatccctgtaccatcaagtgtcagggctattgttgcattaaaccttcac
aattatgcaagtggaaggaatccatggggaaacttgaagcctgaatacttggaaaagaga
ggatttgtcgaagctcaatcagacgatggtcttcttgaaatatttggattgaagcaaggg
tggcatgcatcccttgtgatggttgaactaatatctgcaaagcacatagctcaggcagca
gcaatacgattggagatcaaaggtgggcaatggagggatgcatacatgcaaatggatggg
gagccatggaagcaaccattggaccacgagtactcgacgttcgtcgatatcaagaaggtc
ccttacccatctctaatcatcaatggtggggatcgttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351807
Entry
4351807           CDS       T01015                                 
Name
(RefSeq) diacylglycerol kinase 2
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa00564  Glycerophospholipid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4351807
   00564 Glycerophospholipid metabolism
    4351807
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    4351807
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     4351807
SSDB
Motif
Pfam: DAGK_acc DAGK_cat C1_1 hemP
Other DBs
NCBI-GeneID: 4351807
NCBI-ProteinID: XP_015620748
UniProt: Q2QVN0 A0A8J8YNM3
LinkDB
Position
12:complement(6729624..6734389)
AA seq 707 aa
MDLVGSLLVNMTHLVDTSGLQFFGWLITAGSFGLAALIYALLRLQRAASLYWIKAAAREK
KAAWKSLRCPSSGHTWTEDYFRGGQPSTCCVCLSSLTTAQGVGSRGADAVVVHRCSVCGV
AAHSGCSRGAEKDCKCVSQHGASTLLHHWSERWVELDDNPEMSSFCYYCDEPCGVPFLGV
SPIWRCLWCQRQIHVDCHAKLLKETGNTCDLGLLRRLIVPPLSVKEVAQGPAITGMLNSI
KEGLVTSSVRGRIKRRGNKKRMNNHPGGKTSPVPTNSSILDSVLEGFARLQNLNGKYALA
NHKSSGDSVKQTHGYDSPNGGKKKYEIIDLPQDSRPLLVFINGKSGGRNGPSLRRRLNML
LNPIQIFELSASQGPEVGLQFFHNVKHFRILVCGGDGTVAWVLDAIEKQNYESPPPVSIL
PLGTGNDLSRVMRWGGGLSSVEGQGGICALLNDVDHAAVTVLDRWNVAIKEKNGAEDQCT
KQVKFMTNYIGVGCDAKVAYDFHTTREEKPDKFCSQFVNKLIYAREGAKDIMDRSCSDLP
WHVSLEVDGKNVEIPEDAEGVIVLNIPSYMGGVDLWQNDNEHDDDFGLQSMHDKMLEVVC
ISGTWHLGKLQVGLSRAHRLAQGKVIRLHLHSSFPVQVDGEPWIQPPGCLEISHRGQMFM
LRRTSEEPTGHAAAIMSEVLMNAECNGVIDAAQKRLLLHEIALRLSS
NT seq 2124 nt   +upstreamnt  +downstreamnt
atggaccttgtgggatcgctgctggtgaacatgactcacttggttgacacctcggggctc
cagttcttcggctggctcatcaccgccggctccttcggcctcgccgcgctcatctacgcc
ctcctcaggctgcagagggcggcgtcgctgtactggatcaaggcggctgccagggagaag
aaggcggcgtggaagtcgttgcggtgccccagctccggccacacctggaccgaggactac
ttccgcggcggccagccttcgacgtgctgcgtgtgcctgtcgtccctgaccacagctcag
ggtgtgggctctcggggtgccgatgccgttgtggtccaccgctgctcggtgtgtggggtg
gcggcccattctggctgctctcgtggcgccgagaaggactgcaagtgtgtttcacagcat
ggtgcttccaccttgcttcatcactggtcggagaggtgggtggagctggatgacaaccca
gagatgtcctctttctgttactactgcgatgagccatgtggtgtgccatttctcggcgtc
tctccaatatggcgctgcctgtggtgccagcggcagatccatgttgattgtcatgcaaag
ctgttaaaggagacggggaatacttgtgatctaggccttctcaggaggctcattgttcct
cctctgtctgtgaaagaagttgcccaaggaccagcaattactggaatgctcaactcgatc
aaggaaggtcttgtcacttcatcagttaggggcaggattaagaggcgaggcaacaagaaa
cgcatgaacaaccatcctggtggtaagacaagtccagtccccacaaacagctctatcctt
gattctgtgcttgaagggtttgctagactgcagaacttgaatggaaagtatgcgctggca
aaccataagtctagtggggattctgtcaagcaaacacatggatatgacagccctaatgga
gggaagaaaaagtatgaaatcattgatttgccacaagattcaaggccactgcttgttttc
attaacggcaagagtggaggacgaaatggaccttctcttagaagaaggcttaacatgttg
ctaaatcctatccagatatttgagcttagtgcttctcagggacctgaagttggattgcaa
tttttccacaatgtaaaacacttcagaatccttgtttgtggtggggatgggactgttgca
tgggttcttgatgctattgaaaagcagaactatgaatctcctcctcctgtttccattctt
ccattaggaacaggaaatgacctatctcgtgttatgcgctggggtggaggtctgtcttct
gttgaaggacaagggggaatatgtgcacttctaaatgatgttgaccacgcagcagttacc
gtgcttgatcgctggaatgttgccatcaaagagaagaatggagcagaagatcaatgtacc
aagcaagttaaatttatgactaattatataggtgttggatgtgatgccaaggttgcatat
gacttccacactacgagagaggaaaaaccagataaattttgcagccagtttgtcaacaag
ctgatatatgctagagaaggcgctaaggatatcatggataggtcatgttctgatttacca
tggcatgttagtcttgaagttgatggaaagaacgtcgaaattccagaggacgcagaaggt
gtgattgttctgaacattcctagctacatgggcggtgttgatctttggcaaaacgacaat
gaacatgatgatgattttggtttgcaatccatgcatgacaaaatgcttgaggttgtctgt
atatctgggacgtggcatctaggaaaactgcaggtgggactctctagagcacacaggcta
gcccaagggaaagttataaggttgcatctccacagttcattccctgttcaggttgatggt
gagccatggatccagccacccgggtgccttgagatatctcatcgtgggcagatgttcatg
ttgaggaggacatccgaagaacccaccgggcatgccgctgctatcatgagcgaggtcctc
atgaatgcagagtgcaatggtgtgattgatgctgctcagaagagattgctccttcatgag
atcgcactacgtttgtcctcctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352615
Entry
4352615           CDS       T01015                                 
Name
(RefSeq) diacylglycerol kinase 1 isoform X1
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa00564  Glycerophospholipid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4352615
   00564 Glycerophospholipid metabolism
    4352615
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    4352615
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     4352615
SSDB
Motif
Pfam: DAGK_acc DAGK_cat C1_1 YegS_C
Other DBs
NCBI-GeneID: 4352615
NCBI-ProteinID: XP_015618191
UniProt: Q2QN71
LinkDB
Position
12:complement(23823827..23829520)
AA seq 716 aa
MYKMMYPSWNDISVYISEYWSVIIATVIFASVTGVTIYYTVNQLNKNISLSLMKAIRARA
RKYKKLKDKVPASSHIWRKELGSRSKGLKCCVCLKSVSSPQYMGGVIHQCDICGATAHPS
CSGNAHKDCKCVSMVGFEHVIHQWAVQWIDTSDRSEEDSFCCYCDESCNGAFLAGSPIWY
CMWCQRLVHVDCHNNLSIETGDICDLGPLKRLILSPLCVKELHWTGAAGLISSITHGANE
LASNVRERIRSRGKKYRKGTISVDSDSSGTIDPPSDIEGDSQETNNAAKRREDHANGELP
EVHESSESENDKQLLTENKTSIPNGQHEDSHVHNNQKYEIVDVPSDSRPLLVFINKRSGA
QCGDSLRQRLQILLNPIQVFELGKQQGPEVGLTLFRKVPHFRVLVCGGDGTVAWVLDAIE
KQKFEAPPPVAILPAGTGNDLARVLSWGGGLGIVEKQGGLFSVLKDVEHAAVTVLDRWKI
TIKDNQGKLMSQPKYMNNYFGVGCDAKVALDIHNLREENPERFYSQFMNKVLYAKEGAKN
MMDNTFDYFPWDVKLEIDGSKINIPQDSEGILVANIQSYMGGVDLWKNEDDVSDNFHPQS
MHDKMLEVVSFTGMLHLGRLQVGLSRAQRLAQGHHIKIEIKTKMPIQVDGEPWSQDPCTI
VVSHHCQAFMLKRVSEEPIGHAASIMADVLENAENNGIITASQKRTLLHEIASRLL
NT seq 2151 nt   +upstreamnt  +downstreamnt
atgtacaagatgatgtatcctagctggaatgacatttcagtgtacatatctgagtattgg
tctgttataattgctacagtcatttttgcatctgttactggtgtgacaatttattatact
gtcaatcaattgaacaaaaacatcagcttgagtttgatgaaagctatcagagctagggca
aggaagtacaagaaattgaaagataaggtccctgcctcttcccacatttggagaaaagaa
cttggctctcgtagtaaaggtctgaaatgctgtgtatgcttgaagtctgtttcatctccg
cagtatatggggggagttatccatcagtgtgatatttgtggtgccactgcacatcctagt
tgctcaggaaatgcgcacaaagattgcaaatgtgtttctatggttggttttgaacatgtc
attcatcagtgggctgtacagtggattgacacatcggatcgctctgaggaggattctttc
tgctgctattgtgatgaatcttgcaatggagctttcctcgcaggttctccaatttggtac
tgtatgtggtgccaacggctagtgcatgttgattgtcacaacaacctatctatagaaact
ggtgatatctgtgacttgggccccttgaagcggctaatattgtcacctctttgtgttaag
gagctccattggacaggtgcagcaggacttatcagttctataacacatggggctaatgaa
ttggcttccaatgtccgagagaggatcaggagtcgcggtaaaaagtacagaaagggtacc
atttctgttgattcagatagctctggtactattgacccgccatctgatattgaaggagat
tcacaagaaacaaacaatgcagctaaaaggagagaggatcatgccaatggtgaacttcct
gaagtacatgaaagctctgaatcagagaatgataaacagctgttgacagaaaacaaaact
agcataccgaacggccaacatgaggattcacacgtacacaataatcagaaatatgaaatc
gtggatgtgccttctgattctaggccattgctagtgtttattaacaagagaagtggagca
cagtgtggtgattcactgagacaacgtttgcagatccttcttaatcctatccaggttttt
gagctgggtaaacagcaaggaccagaagttggtttgactttgtttaggaaggtaccccac
ttcagagttcttgtttgtggtggagatggcaccgttgcttgggtcctggatgccattgag
aaacagaagtttgaagctccaccacctgtggccatccttccagctggtactggtaatgat
cttgccagggttttgtcttggggtggtggtctcggaattgttgagaaacagggaggtctg
ttctctgttttaaaagatgtcgagcatgcagcagttactgttcttgatagatggaagatc
acaataaaagacaaccaagggaagcttatgtcacaaccaaaatatatgaacaactacttt
ggggttggctgtgatgcaaaggttgctttagatatccacaatctgagggaggaaaaccct
gaacgtttttatagtcagtttatgaacaaggtgctttatgcaaaagagggagcaaagaat
atgatggataacacatttgattattttccatgggatgtcaagcttgagatagatggatcc
aaaattaatattcctcaggactctgaaggtatccttgttgccaatattcagagctacatg
ggaggagttgacctgtggaagaacgaggatgatgtttctgacaatttccaccctcagtca
atgcatgacaagatgctagaagtagttagcttcactggaatgctgcatcttggaaggctg
caggtagggctttctcgcgcgcagaggttagctcaaggtcatcatataaagatcgagatc
aaaactaaaatgcccattcaagtcgatggagagccttggtcgcaggatccatgcaccata
gtagtttcacatcactgccaggctttcatgctgaagagagtctccgaagaacctatcggc
catgcggcctccataatggccgacgttctggaaaacgccgagaataacggcatcatcaca
gcgtcgcagaagaggaccctcctccacgaaatagcttctaggcttttgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9266342
Entry
9266342           CDS       T01015                                 
Name
(RefSeq) diacylglycerol kinase 1
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa00564  Glycerophospholipid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    9266342
   00564 Glycerophospholipid metabolism
    9266342
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    9266342
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     9266342
SSDB
Motif
Pfam: DAGK_acc DAGK_cat C1_1
Other DBs
NCBI-GeneID: 9266342
NCBI-ProteinID: XP_015627959
UniProt: Q75GS1
LinkDB
Position
3:17754764..17761088
AA seq 739 aa
MMSSFQGYNFLEPSTSMIVWWRDQFRKLMFNWHSKTLNLSELWIPIVVCFTIGIVGLLTV
LYLFSLWRRKISLSWMKMIARSKRKNFERTHKVPTAEHVWSVESLLRAKGLKCCVCLESI
SPAQPLGQMTTSENMVHRCDVCGAAAHMICSSNSQKDCKCVSMFGSKHVVHQWTVLWTDI
ADQSEEAQYCSYCEEPCSGSFLGGPPIYCCMWCQRLVHVDCHSSMATETGDICDLGPFKR
LILSPLFVKTRSKPGGILSSITHGANEFASTVRGHLRNRSKKQKEHSRVPSDCNVGDSND
DSSCDTAANANQRAKDLKSSGDNVQRSAENEHDSSESDCKEVIPEPRRLHHDDAEGAKLK
YILDDLPADARPLLVFINKRSGAQRGDSLKHRLHFLLNPVQVFELSSSQGPEIGLLLFRK
VPHFRILVCGGDGTVGWVLDAIDKQNYESPPPVAILPAGTGNDLSRVLSWGGGLGAVEKQ
GGLCTVLHDIEHAAVTILDRWKVAIEDKRGKNVLMVKYMNNYLGIGCDAKVALDIHNLRE
ENPEKFYSQFLNKVLYAREGAKSMIDRTFVDLPWQVRLEVDGTEIEIPEDSEGVLVANIP
SYMGGVDLWKSEDDNPDNFDPQSIHDKMVEVVSISGTWHLGTLQVGLSRARRIAQGQSIK
IQIFAPFPVQVDGEPWTQNPCTLKISHHGQAFMLRRTIEESLGHAAAIVTDVLENAESSH
LITASQKRALLQEMALRLS
NT seq 2220 nt   +upstreamnt  +downstreamnt
atgatgtcctcatttcaaggttataatttcttggaaccatcaacttcaatgattgtctgg
tggagagatcaatttagaaaacttatgttcaattggcacagtaaaacccttaatctgtca
gaactctggatcccaattgtggtttgtttcaccattggtatagttggtcttttgacagtt
ttgtaccttttctcactatggagacgaaagatcagtttgagctggatgaaaatgatagca
agatcaaaaaggaagaattttgaaagaacccacaaggttccaactgctgaacatgtttgg
agtgtagaatctttacttcgtgcaaaaggactgaagtgctgtgtgtgtttagaatctatt
tcacctgctcagccccttgggcaaatgacaacatctgagaatatggttcaccggtgtgat
gtctgcggtgcagctgcacacatgatctgttcttcaaattctcagaaggactgcaaatgt
gtttcaatgtttggatcaaaacatgttgtccatcaatggaccgtactctggacagatata
gctgatcagtctgaagaagctcaatactgtagttactgtgaggagccatgcagtggatct
tttcttggaggccctcctatatactgctgcatgtggtgccaacggttggtgcatgttgat
tgccactcaagcatggctacagagacaggtgatatttgtgatctcggtccattcaaacgc
cttattctttcgcctctttttgtgaaaaccaggagcaagcctggtggaattttaagttcc
ataacacatggtgcaaatgaatttgcatccactgtgagggggcatctcaggaaccgaagc
aagaagcagaaggaacatagcagggtaccttctgactgtaatgttggtgacagtaatgat
gattcatcatgtgataccgcagcaaatgctaatcagagggctaaggacttgaaatcatct
ggggacaatgttcagaggagtgctgagaatgagcatgatagcagcgagagtgattgtaaa
gaagttataccagagcctagaagattacaccatgatgatgctgaaggagctaaacttaag
tacatactggatgacttgcctgctgatgccagaccccttctagtgttcatcaacaaaaga
agtggggctcaacgtggagattctctaaagcaccgcctacattttcttttgaatccagtt
caggtgtttgagctgagttcatcacaagggccagagataggattattattgttccgaaag
gtaccacatttcagaatccttgtatgtggtggagatggtactgttggttgggttcttgat
gcaatagataaacaaaattatgaatcacctccgcctgttgcgattcttccagctggcact
gggaatgatctttcaagagttttatcttggggaggtggtctaggtgctgttgagaagcaa
ggaggcctctgcacagttctacatgacatagagcatgcagcagtgaccatcttagataga
tggaaggtggcaattgaagataagcgaggaaaaaatgtgcttatggtgaagtatatgaac
aattatctaggtatcggttgtgatgcaaaggttgctcttgacattcataatctccgggaa
gaaaatcctgaaaagttctatagtcagtttttaaataaggtgctatatgcaagggaaggt
gcaaagagtatgatcgatagaacttttgtggacttaccctggcaagttagattagaggtt
gatggaactgagattgagattccagaggattcagaaggtgttctggttgcaaacattccg
agctacatgggaggggttgatttgtggaaaagcgaggatgataaccctgacaactttgac
ccacagtcaattcatgacaagatggttgaagtagttagcatctccggaacttggcatctg
gggacacttcaggttgggctttctcgggcacggaggattgctcaaggacaatcaatcaaa
atacaaattttcgctccatttccagttcaagtggatggcgaaccatggacccaaaacccc
tgcactctcaaaatatcccatcatggacaggcttttatgttgaggagaacaattgaggag
tctctcggtcatgctgctgcaatcgtcactgatgtgcttgaaaatgctgaatctagtcac
ctaatcactgcatctcagaagagggccctcctccaagaaatggctctgaggctttcataa

DBGET integrated database retrieval system