KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327080
Entry
4327080           CDS       T01015                                 
Name
(RefSeq) protein IWS1 homolog A
  KO
K03504  DNA polymerase delta subunit 3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
osa03410  Base excision repair
osa03420  Nucleotide excision repair
osa03430  Mismatch repair
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4327080
   03410 Base excision repair
    4327080
   03420 Nucleotide excision repair
    4327080
   03430 Mismatch repair
    4327080
   03440 Homologous recombination
    4327080
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:osa01009]
    4327080
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4327080
   03400 DNA repair and recombination proteins [BR:osa03400]
    4327080
Protein phosphatases and associated proteins [BR:osa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     4327080
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    4327080
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      4327080
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     4327080
SSDB
Motif
Pfam: CDC27 MsyB
Other DBs
NCBI-GeneID: 4327080
NCBI-ProteinID: XP_015624950
UniProt: Q5QNL2 A0A8J8XUI1
LinkDB
Position
1:complement(5718900..5724193)
AA seq 512 aa
MAAAAADPALLDLIPQIHALFADPLRVISYKWLSRNFSVSSNDSKRLLQEFVNKHGADLK
VIYSVSGWLKKNPTNYCVKLTSGHKLEEARQEFKDSCSVQVYSIQACIPKDTAVLWNPEF
VQAEELFNRPFDEENCLRDNRFCGVLNSFVKRTANGKLVSSFPPKPINSVAAAAPLKTSS
APKEQSAKGQQQGLPGSSSPKKGTSNKAEKDISSVLDKATNAPVVKEPSIALQGNKNKAQ
NGKALPSNGGSLATMWGRASAKPKTPATTNPTVLPSVAVTADAQICAKEEANADSSDDEQ
AVHYKRGSSANNRKRRAVFDLSDDDEDDNVVAIASPEPPEQCITNPIDEVAQESNPKQEN
LENKQEVEKDVKCCIGRTESPECKTKSSNTVSHSGITLKEKNNGPPPNDNKQDHAAETAS
NSPKRRKVLKTRIDERGREVTEVVWEGEASAGDKAEKNVSDTGAANRATLSSKPQPVAKT
EKSNASSKTAGNKKPAKAGTKQGNIMSFFKKV
NT seq 1539 nt   +upstreamnt  +downstreamnt
atggcggccgccgccgcggacccggccctgctcgacctgattccccagatccacgccctc
ttcgccgatccgctccgtgtgatttcatacaaatggctcagcaggaacttctcagtatca
tccaatgattcaaagaggttgcttcaggagttcgtcaacaaacatggggctgatcttaaa
gtgatttacagtgtgtctggatggttaaagaagaaccccacaaattattgtgtaaaactc
acttcaggccataaacttgaagaagcaaggcaagaatttaaagattcttgttcagttcaa
gtgtacagtatccaggcttgtattccaaaagatactgctgtactttggaatcctgaattt
gtacaggcagaggagctttttaaccggccatttgatgaagaaaattgtttgagagataat
aggttttgtggtgttttgaattcttttgtcaagcgaactgctaatgggaagcttgtgagt
tcatttccgccaaagcctataaatagtgttgctgcagctgcaccgttgaaaactagtagt
gctccaaaagaacaatctgctaagggtcaacagcaaggtctacctggatcatccagtcca
aagaaaggaacaagtaataaggctgagaaggatatttcctcggtcttggataaagccacc
aatgctcctgttgtcaaagaaccatcaattgctctgcagggaaacaaaaacaaggctcag
aatgggaaggcgctgcccagtaatggtggatcacttgctacgatgtggggacgtgcatca
gctaaacccaagactccagctaccactaatcctacagttttaccaagtgttgctgttaca
gctgatgcacaaatatgtgcaaaggaagaagcaaatgctgatagtagtgatgatgaacaa
gctgtacactacaagcgtggctctagtgcaaataacagaaagagaagagcagtctttgat
ctttcagatgatgatgaagatgacaatgttgtagccattgcatctcctgagccaccggaa
cagtgcattacaaatcctattgatgaggttgctcaagaaagtaaccccaaacaagaaaac
ttggaaaataaacaagaggttgagaaggatgtgaaatgttgcataggaaggacagagtct
cctgagtgtaaaaccaaaagtagcaacactgtcagccattctgggatcaccttaaaagaa
aagaacaatggtccaccacctaatgacaataagcaggatcatgctgctgagactgcttcc
aactcacctaaaagaaggaaagttttgaagacacgaatagatgagcggggaagagaagta
accgaggttgtctgggagggtgaagcttctgcaggtgataaggctgagaagaatgtgagc
gatactggtgctgcaaacagggcaactctctcaagcaagccgcagccagtagcaaagacc
gaaaaaagcaatgcttcgagtaaaacagccggcaacaagaaacctgccaaggctggaacc
aagcaaggcaacattatgtcattcttcaagaaggtataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331489
Entry
4331489           CDS       T01015                                 
Name
(RefSeq) DNA polymerase delta small subunit
  KO
K02328  DNA polymerase delta subunit 2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
osa03410  Base excision repair
osa03420  Nucleotide excision repair
osa03430  Mismatch repair
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4331489
   03410 Base excision repair
    4331489
   03420 Nucleotide excision repair
    4331489
   03430 Mismatch repair
    4331489
   03440 Homologous recombination
    4331489
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4331489
   03400 DNA repair and recombination proteins [BR:osa03400]
    4331489
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    4331489
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      4331489
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     4331489
SSDB
Motif
Pfam: DNA_pol_E_B DNA_pol_D_N
Other DBs
NCBI-GeneID: 4331489
NCBI-ProteinID: XP_015629014
UniProt: Q9LRE5
LinkDB
Position
3:complement(1612382..1616472)
AA seq 429 aa
MERKQAEYSNLDERYAIQGEKYQGQQYSHIYFTRLHHMRNLLHALVPSWKPHLPVTTVLG
LEEGKDCIIVGTLYKHMKLKPSILDEYSKERSAIPLVKPHNFMHPDDHLILEDESGRVTL
AGAIPPAAYVTGVVIALHGKETSAGNFLVEDILEAGIPPQITLPSINEDKYVVFVSGLSI
GSEKFNPLQFQLLIDHITGHLGDENEQSIASNIVRVVVAGNSVHISPRFFNGQAVASKDQ
SRIAEPIKELDIMLTQLVASLPVDMMPGSNDPANFSLPQQPLHRCLFAGAATYNTFSSCS
NPHQFELDSVRFIGTSGQNIDDLYKYSDAKDKLEFVERTLRWRHLAPTAPNSLGCYPYTD
KDPFLVESCPHVYFVGNQDKYETQLLQGLEKQKVRLICIPRFCDSGVAVMLNLRNLECST
LSFSTSFDA
NT seq 1290 nt   +upstreamnt  +downstreamnt
atggagaggaagcaggcggagtacagcaacctcgacgagaggtacgcgatccagggggag
aagtaccaggggcagcagtacagccacatctacttcacgcgactccaccacatgcgcaac
ctcctccacgccctcgtcccctcctggaagccgcaccttcctgttactactgtgttggga
cttgaagaaggaaaggattgcataatcgttggaactttatataagcacatgaaattaaag
ccttccattcttgatgaatattctaaggagaggtctgctattcctcttgttaaaccacac
aatttcatgcatcctgatgatcatctcattctggaagatgaaagtgggagagttacactt
gcaggagccatacctccagcagcatatgttactggagttgtaatagctttacatgggaaa
gaaacaagtgctggcaactttcttgttgaagatattcttgaggctgggattcctcctcaa
attacgttacctagcataaacgaggacaaatatgtggtatttgtgtcgggattaagtatt
gggagtgaaaaattcaatcctctgcaattccaacttcttatagaccatatcacagggcat
ttgggtgatgagaatgagcaatccatagcatccaacatagtacgtgttgtggtggctggg
aattcggtacatatttctccaagattcttcaatggtcaggcagtagcatcgaaagatcaa
tccaggatagctgaaccaatcaaagaattggatataatgctcactcagcttgtggcatca
ttgcctgtggacatgatgcctggatctaatgacccagcaaatttttctttgcctcaacag
cctttgcatagatgcctttttgctggagcagccacttataacactttttcatcgtgctcg
aatccacatcaattcgagcttgatagtgtccggtttattggaacatctggacagaacata
gatgacctctacaagtactctgatgccaaagacaagctggaattcgtggaaagaacactg
cggtggcgtcatcttgctccaactgctccaaacagtctaggatgttatccatacacagac
aaggatccttttctcgttgaaagctgtccccatgtttacttcgtcgggaatcaagataaa
tatgaaactcaattattgcaagggctagaaaaacaaaaagtgaggctgatctgcattcca
agattttgtgatagtggagttgctgtcatgctcaatttgaggaacttggagtgcagcacg
ttgagtttctcaacaagcttcgatgcttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344737
Entry
4344737           CDS       T01015                                 
Name
(RefSeq) DNA polymerase delta subunit 4
  KO
K03505  DNA polymerase delta subunit 4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
osa03410  Base excision repair
osa03420  Nucleotide excision repair
osa03430  Mismatch repair
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4344737
   03410 Base excision repair
    4344737
   03420 Nucleotide excision repair
    4344737
   03430 Mismatch repair
    4344737
   03440 Homologous recombination
    4344737
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4344737
   03400 DNA repair and recombination proteins [BR:osa03400]
    4344737
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    4344737
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      4344737
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     4344737
SSDB
Motif
Pfam: DNA_pol_delta_4
Other DBs
NCBI-GeneID: 4344737
NCBI-ProteinID: XP_015649425
UniProt: Q0J7T7
LinkDB
Position
8:complement(3727995..3728870)
AA seq 122 aa
MRSGGDVRSFFRQQKAHAAGGVKPTGGVSKKAALPRHHHKPASQATPDRAVDDARRHVEE
AEEEEGRERMAREFDMDMRYGPCLGLTRAQRWRRAAALGLAPPPAVIAVCSDDQPCLWEG
RV
NT seq 369 nt   +upstreamnt  +downstreamnt
atgaggagcggcggcgacgtcaggtccttcttccggcagcagaaggcccacgccgccggc
ggcgtcaagcccaccggcggcgtctccaagaaggcggcgctgccccgccaccaccacaag
cccgcgtcgcaggcgacgccagatcgcgccgtcgacgacgcgaggaggcacgtcgaggag
gcggaggaggaggaggggcgggagaggatggctcgggagttcgacatggacatgcggtac
gggccctgcctcggcctcacccgcgcccagcgctggcgccgcgccgccgcgctcggcctc
gccccgccgcccgccgtcatcgccgtctgctccgacgaccagccgtgcctctgggagggc
cgcgtctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347604
Entry
4347604           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC4347604
  KO
K03505  DNA polymerase delta subunit 4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
osa03410  Base excision repair
osa03420  Nucleotide excision repair
osa03430  Mismatch repair
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4347604
   03410 Base excision repair
    4347604
   03420 Nucleotide excision repair
    4347604
   03430 Mismatch repair
    4347604
   03440 Homologous recombination
    4347604
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4347604
   03400 DNA repair and recombination proteins [BR:osa03400]
    4347604
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    4347604
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      4347604
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     4347604
SSDB
Motif
Pfam: DNA_pol_delta_4
Other DBs
NCBI-GeneID: 4347604
NCBI-ProteinID: XP_015651399
UniProt: Q64MB0 A3C0Q3
LinkDB
Position
9:complement(20313567..20315721)
AA seq 131 aa
MASGGMKDFYRQKKKGGPTKASSSSKKKTQHYTGGASVGASDTAQTSALISHGNLDLKDD
FSEQEEQLRLFDMDMKFGPCIGVTRLQRWERASAMGLHPPPHLRDLLLNNTHAGNHNNNG
PSLECLWEGKV
NT seq 396 nt   +upstreamnt  +downstreamnt
atggcttctggtggcatgaaggacttttaccggcagaagaagaaaggaggtcccaccaaa
gcatcgtcatcttccaagaagaaaacacagcattacactggaggggcctctgttggggcc
tcagacactgctcagacatcagcactaatttctcatggtaacctagatcttaaagatgat
ttcagtgagcaagaggagcagttgcgactgtttgatatggacatgaagtttggcccttgc
attggcgttactcgtcttcagcgttgggaacgtgcttctgccatgggtcttcacccacca
cctcatctcagggatctcttactgaacaatactcatgcaggcaatcacaataacaatggt
ccctcccttgagtgcctctgggagggcaaagtctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349968
Entry
4349968           CDS       T01015                                 
Name
(RefSeq) DNA polymerase delta catalytic subunit
  KO
K02327  DNA polymerase delta subunit 1 [EC:2.7.7.7]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
osa03410  Base excision repair
osa03420  Nucleotide excision repair
osa03430  Mismatch repair
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4349968
   03410 Base excision repair
    4349968
   03420 Nucleotide excision repair
    4349968
   03430 Mismatch repair
    4349968
   03440 Homologous recombination
    4349968
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4349968
   03400 DNA repair and recombination proteins [BR:osa03400]
    4349968
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     4349968
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    4349968
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      4349968
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     4349968
SSDB
Motif
Pfam: DNA_pol_B DNA_pol_B_exo1 zf-C4pol DNA_pol_B_2 divDNApol
Other DBs
NCBI-GeneID: 4349968
NCBI-ProteinID: XP_015617044
UniProt: Q9LRE6
LinkDB
Position
11:complement(4387460..4397803)
AA seq 1105 aa
MSSGGRGGKRRGAPPPGPSGAAAKRAHPGGTPQPPPPAATAAAPVAEEEDMMDEDVFLDE
TILAEDEEALLLLDRDEALASRLSRWRRPALPADLASGCSRNVAFQQLEIDYVIGESHKV
LLPNSSGPAAILRIFGVTREGHSVCCQVHGFEPYFYISCPMGMGPDDISRFHQTLEGRMK
DSNRNSNVPRFVKRIELVQKQTIMHYQPQQSQPFLKIVVALPTMVASCRGILERGITIEG
LGSKSFLTYESNILFALRFMIDCNIVGGNWIEVPAGKYMKAARIMSYCQLELDCLYSDLV
SHAAEGEHSKMAPFRILSFDIECAGRKGHFPEPTHDPVIQIANLVTLQGEGQPFVRNVMT
LKSCSPIVGVDVMSFDTERDVLLAWRDFIREVDPDIIIGYNICKFDLPYLIERAEVLKIV
EFPILGRIRNSRVRVRDTTFSSRQYGMRESKDVAVEGRVQFDLLQAMQRDYKLSSYSLNS
VSAHFLGEQKEDVHHSIISDLQNGNSETRRRLAVYCLKDAYLPQRLLDKLMYIYNYVEMA
RVTGVPISFLLSRGQSIKVLSQLLRKAKQKNLVIPNIKGQASGQDTFEGATVLEARAGFY
EKPIATLDFASLYPSIMMAYNLCYCTLVPPEDARKLNLPPESVNKTPSGETFVKPDVQKG
ILPEILEELLAARKRAKADLKEAKDPFERAVLDGRQLALKISANSVYGFTGATVGQLPCL
EISSSVTSYGRQMIEHTKKLVEDKFTTLGGYEHNAEVIYGDTDSVMVQFGVSTVEDAMKL
GREAADYISGTFIKPIKLEFEKIYFPYLLISKKRYAGLYWTNPEKFDKMDTKGIETVRRD
NCLLVKNLVTECLHKILVDRDVPGAVQYVKNTISDLLMNRVDLSLLVITKGLTKTGEDYA
VKAAHVELAERMRKRDAATAPTVGDRVPYVIIKAAKGAKAYERSEDPIYVLDNNIPIDPQ
YYLENQISKPLLRIFEPILKNASRELLHGSHTRAVSISTPSNSGIMKFAKKQLTCLGCKA
VISGSNQTLCFHCKGREAELYCKTVGNVSELEMLFGRLWTQCQECQGSLHQDVLCTSRDC
PIFYRRRKAQKDMAEARVQLQRWDF
NT seq 3318 nt   +upstreamnt  +downstreamnt
atgagctcaggcggacgcggcggcaagcggcgaggggcgccgcccccggggccatccggg
gcggcggcgaagcgggcccaccccggtggcaccccgcagccgcctccgcccgccgcgacg
gcggcggcgcccgtggcggaggaggaggacatgatggacgaggacgtcttcctcgacgag
accatcctggcggaggacgaggaggcgttgctgctgctcgaccgggacgaggccctcgcc
tcacgcctctcccgctggaggcgccccgcgctccccgccgacctagcgtccggctgctcg
cgcaatgttgcttttcagcagctggagatagattatgttattggtgagagccacaaagta
ctgctccccaactcatctggtcctgcagctatactcaggatatttggcgtaactagagaa
ggtcacagtgtatgctgccaagtgcatggatttgagccatatttctacatcagttgtcca
atggggatgggccctgatgatatttcacgcttccaccaaacactagaggggaggatgaag
gattcaaataggaacagcaacgtgccaaggtttgtgaagagaatcgaacttgtgcagaag
cagacaatcatgcattaccaaccacagcaatctcagcctttcctcaagatagtggttgct
ttgccaacaatggttgctagttgtcgcggcatcctggaaaggggcataacaattgaaggc
cttggttcgaagagttttctgacatatgaaagcaacattctttttgcacttcgcttcatg
attgactgcaatattgttggtggtaattggattgaagttcctgccggaaagtatatgaag
gcagctcgtatcatgtcctattgtcagctagagttggattgcctatattcggatttggta
agccatgctgctgaaggagaacattctaagatggctccatttcgcatattaagttttgat
attgaatgtgccggtcgcaaaggtcacttcccagaaccaactcatgatcccgttattcag
atagctaacttggtcacccttcaaggagaaggacaaccttttgtacgcaatgttatgacg
cttaaatcatgttctcccattgttggagttgatgttatgtcatttgacacagagagggat
gttctacttgcttggagggatttcatacgtgaagtggaccctgatattattattggatac
aatatctgcaaatttgacttaccctatcttattgagagagctgaagttcttaagatagta
gagtttccaatacttggacgaatcagaaatagtcgtgttcgtgtccgtgacacaactttc
tcttcaaggcaatatggtatgcgtgaaagtaaagatgtagcagtggaaggaagagtacaa
tttgatcttctgcaggctatgcaacgggattacaagcttagttcttattcattaaactct
gtatctgcacatttcctcggggagcaaaaagaggatgttcatcactcaattatatctgat
cttcaaaatgggaattcagagacacgaagacggcttgcggtttattgtttgaaggatgcc
tatcttccacaacgactgctagataagttgatgtatatctacaactatgtggaaatggca
agagtcactggagttcccatttcatttcttctttcaaggggacagagcattaaggtcctc
tcacagctactcaggaaagcaaaacagaaaaaccttgttataccaaatataaagggtcaa
gcgtctggacaggatacctttgaaggtgcaactgttttggaggcaagggctggattttat
gagaaacccattgcgactttggactttgcttcgttgtatccatccatcatgatggcatat
aacctatgctactgtactttggtcccccctgaggatgcccgcaaactcaacctgcctcca
gaaagtgtcaacaaaaccccatctggtgaaacatttgtgaaaccagatgtgcaaaagggt
atacttcctgaaatccttgaagaattgttggctgctcggaaaagggcgaaagcagatttg
aaggaagcaaaggatccatttgaaagggccgttcttgatggtcgtcagcttgccctaaaa
ataagcgcaaactctgtctatggttttactggagcgactgttggtcaattaccttgttta
gaaatttcttcaagtgtgaccagctatggtcgacagatgattgaacatacaaaaaagctt
gttgaagataaattcacgacacttggaggctatgagcacaatgcagaggtcatctatgga
gatactgattctgtaatggtacagttcggtgtttctactgttgaggacgcaatgaagcta
ggaagagaagctgcagactacattagtggaacatttattaagcccatcaagcttgagttt
gagaagatctatttcccttatctactgattagcaagaagagatatgctggtttgtactgg
acaaatcctgagaaatttgacaaaatggacacgaaaggtattgaaacagtgagaagggac
aactgtttattagtaaagaacctggttactgagtgccttcataaaatactagtggacaga
gatgttcctggtgcagttcaatatgtcaagaacaccatttctgatctactaatgaaccgt
gtagacttatctcttctagttataacaaagggtttgactaaaacaggagaggattatgct
gtcaaagctgcccatgtggagcttgctgagagaatgcgaaagagggacgctgctactgct
cctactgttggtgaccgggttccttatgttataatcaaagcagcaaaaggggcaaaggca
tatgagaggtcagaagatcctatttatgttttggataataacataccaatagatccccaa
tactaccttgagaaccaaatcagcaaaccacttttgaggatctttgagccgattctgaag
aatgccagtagagagctgcttcatggaagtcacaccagggctgtttcaatctcaactcct
tcaaatagtggaataatgaaatttgcaaagaaacaattgacatgcctcggatgcaaagca
gttataagtggttccaatcaaacgctttgctttcattgcaagggaagagaagcagagtta
tactgcaaaactgtaggaaacgtttctgagctggagatgctctttgggaggctctggacg
cagtgccaggagtgccaaggctcccttcatcaggacgttctctgcacaagccgggattgt
cctattttctaccgccgaagaaaggcgcagaaggatatggctgaagctagagtacagctt
caacgttgggacttctga

DBGET integrated database retrieval system