KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327087
Entry
4327087           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L11-like
  KO
K02868  large subunit ribosomal protein L11e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4327087
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4327087
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4327087
SSDB
Motif
Pfam: Ribosomal_L5_C Ribosomal_L5 DUF1203
Other DBs
NCBI-GeneID: 4327087
NCBI-ProteinID: XP_015617797
UniProt: Q9LWN1 Q0JPS5
LinkDB
Position
1:5769993..5772281
AA seq 182 aa
MASEKKQANPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFSKARYTVRSFG
IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP
STGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKAQAN
TS
NT seq 549 nt   +upstreamnt  +downstreamnt
atggcgtcggagaagaagcaggcgaacccgatgcgggagatcaaggtgcagaagcttgtc
ctcaacatctccgtcggcgagagcggagatcgcctcacccgcgcctcgaaggtgctggag
cagctgagtgggcagtcaccggtgttctccaaggcgaggtacactgtgaggtcgttcggc
atccggcgtaatgagaagatcgcgtgctacgtgacagtgcgtggtgagaaggcaatgcag
ctcctggagagtggcctgaaggtgaaggagtacgagctgctgaggaggaacttcagtgag
actggatgctttggttttggtatccaggagcacattgatcttggcatcaagtatgaccca
tccactggtatttacggtatggacttctacgtcgttcttgagcgtgctgggtaccgtgtt
gcgcggcgccgtaggtgcaagtcccgtgttggtatccagcacagggtcaccaaggaggat
gccatgaagtggttccaggtcaagtacgagggtgtcatcctcaacaaggcccaagccaac
acctcctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328826
Entry
4328826           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L11-like
  KO
K02868  large subunit ribosomal protein L11e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4328826
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4328826
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4328826
SSDB
Motif
Pfam: Ribosomal_L5_C Ribosomal_L5
Other DBs
NCBI-GeneID: 4328826
NCBI-ProteinID: XP_015626740
UniProt: Q0E2I8 A0A0P0VGV0
LinkDB
Position
2:7676772..7687450
AA seq 182 aa
MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG
IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
STGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKAQAN
TS
NT seq 549 nt   +upstreamnt  +downstreamnt
atggcgtcggagaagaagcagtcgaacccgatgcgggagatcaaggtgcagaagctcgtc
ctcaacatctccgtcggcgagagcggcgaccgcctaacccgcgcctccaaggtgctggag
cagctcagcgggcagaccccggtgttctccaaggcgaggtacaccgtgcggtcgttcgga
atcaggcgtaacgagaagatcgcgtgctacgtgacggtgagaggggagaaggcgatgcag
ctgctggagagcgggctcaaggtcaaggagtacgagctgctcaggaggaacttcagtgac
accggatgcttcggcttcggtatccaggagcacattgatcttggcatcaagtacgacccc
tcaacaggtatctatggaatggacttctatgttgtgcttgagcgtgctggctaccgtgtt
gcccgtcgtcggaggtgcaagtctcgcgttgggatccagcaccgggtgaccaaggaggat
gccatgaagtggttccaggtcaagtatgaaggagtcatcctcaacaaggcccaggcgaat
acctcttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338077
Entry
4338077           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L11
  KO
K02868  large subunit ribosomal protein L11e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4338077
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4338077
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4338077
SSDB
Motif
Pfam: Ribosomal_L5_C Ribosomal_L5 DUF1203
Other DBs
NCBI-GeneID: 4338077
NCBI-ProteinID: XP_015640554
UniProt: Q0DK10
LinkDB
Position
5:6649473..6651825
AA seq 182 aa
MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFSKARYTVRSFG
IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP
STGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKAQAN
TS
NT seq 549 nt   +upstreamnt  +downstreamnt
atggcgtcggagaagaagcagtcgaacccgatgcgggagatcaaggtgcagaagctcgtg
ctcaacatctccgtcggcgagagcggcgacaggctcacccgcgcctccaaggtgttggag
cagctgagtgggcagagcccagttttctccaaggcgaggtacaccgtgaggtcattcggt
atccgtcgtaacgagaagatcgcgtgctacgtcaccgtcaggggcgagaaggccatgcag
cttttggagagtggcctcaaggtcaaggagtacgagctgctgaggaggaacttcagcgag
accggatgcttcgggttcggtatccaggagcacattgatcttggcatcaagtacgacccg
tcaactggtatttatggcatggacttctatgttgttcttgagcgtgctggataccgtgtt
gctcgccggcgcaggtgcaagtcccgtgttggaatccagcacagggtgaccaaggaagat
gccatgaagtggttccaggtcaagtatgagggtgtcatcctcaacaaggcccaagcaaac
acgtcgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341262
Entry
4341262           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L11
  KO
K02868  large subunit ribosomal protein L11e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4341262
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4341262
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4341262
SSDB
Motif
Pfam: Ribosomal_L5_C Ribosomal_L5 DUF1203
Other DBs
NCBI-GeneID: 4341262
NCBI-ProteinID: XP_015641087
UniProt: Q0DK10
LinkDB
Position
6:complement(20851110..20853827)
AA seq 182 aa
MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFSKARYTVRSFG
IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP
STGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKAQAN
TS
NT seq 549 nt   +upstreamnt  +downstreamnt
atggcgtcggagaagaagcagtccaacccaatgagggagatcaaggtgcagaagctggtg
ctcaacatctccgtcggggagagcggagatcgcctcacccgtgcctccaaggtcttggag
caactgagtgggcagtcaccagtgttctctaaggctagatacaccgttcgctcatttggc
atcaggcgtaatgagaagattgcgtgctatgtaactgttaggggtgagaaggcaatgcag
cttcttgagagtggactgaaggtgaaggaatatgaacttctgagaagaaacttcagtgaa
actgggtgttttggttttggaatccaggagcacattgatcttggcatcaagtatgatcct
tcaacaggtatttatggcatggacttctatgttgtccttgagcgtgctggataccgtgtt
gctcgccgtcgcaggtgcaagtcccgtgttggcattcagcaccgggtgaccaaggaggat
gccatgaagtggttccaggtcaagtacgaaggtgttatcctcaacaaggcccaggctaat
acatcttaa

DBGET integrated database retrieval system