KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327126
Entry
4327126           CDS       T01015                                 
Name
(RefSeq) NADH-cytochrome b5 reductase-like protein
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4327126
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     4327126
SSDB
Motif
Pfam: NAD_binding_1 FAD_binding_6 NAD_binding_6
Other DBs
NCBI-GeneID: 4327126
NCBI-ProteinID: XP_015621896
UniProt: Q0JQA1 B9ETE0
LinkDB
Position
1:complement(3820183..3824531)
AA seq 311 aa
MAALLLRRLAGTHRGRVPLAAAAAVTGGAALFCASSPPTIALMEEKGEDAAAKVALNPDK
WLEFKLQEKATVSHNSQLFRFSFDPSTKLGLDVASCLITRAPIGEEVEGGRKFVIRPYTP
ISDPDSKGYFDLLIKVYPDGKMSQYFASLKPGDVVEVKGPIEKLRYSPNMKKQIGMIAGG
TGITPMLQVVRAILKNPDDNTQVSLIYANVSPDDILLKRELDRLASSYPNFKVFYTVDKP
SNDWRGGVGYISKDIALKGLPRPGEDSLILVCGPPGMMNHISGDKAKDRSQGELTGILKE
LGYTAEMVYKF
NT seq 936 nt   +upstreamnt  +downstreamnt
atggcggcgctgctgcttcgtaggctcgccgggacccaccgcggccgcgtgcctctggcc
gccgccgccgccgtcaccggtggagcggcgctcttctgcgcctcgtctcccccaaccatc
gcgctcatggaggagaagggcgaggatgccgctgctaaagttgcgcttaacccagacaag
tggctagagttcaagctccaggagaaggcaacagttagccacaattcacaattatttaga
ttttcgtttgacccatctactaagttgggtcttgatgttgcttcatgtctcataacaagg
gctccaataggagaggaagtggagggaggaagaaaatttgtcattcgcccgtacacacct
atctctgatccagattctaaaggatattttgacctgctaatcaaggtttatcctgatggg
aaaatgagtcagtatttcgcaagtctgaaaccaggagatgttgttgaggtcaaagggccc
attgaaaagctcagatatagcccaaatatgaagaaacaaattggcatgatcgctggtggg
actggcataacaccaatgctgcaggttgtcagggctatcctaaaaaaccctgatgacaac
actcaggtttccttaatttatgccaatgtgtcaccagatgatatcttgctgaaaagggaa
ttagatagacttgccagtagctatcctaatttcaaggtattctacacggtggacaaacca
tcaaatgattggaggggtggtgttggctacatatccaaggacattgccttgaaaggtttg
ccacggccaggggaggattctctgatccttgtttgtggtcctccaggtatgatgaatcat
atatccggtgacaaggcaaaggatagatcgcagggcgagctcaccggcattctgaaagag
ttaggatacactgcagagatggtatacaagttctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327480
Entry
4327480           CDS       T01015                                 
Name
(RefSeq) NADH--cytochrome b5 reductase 1
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4327480
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     4327480
SSDB
Motif
Pfam: FAD_binding_6 NAD_binding_1 NAD_binding_6
Other DBs
NCBI-GeneID: 4327480
NCBI-ProteinID: XP_015634676
UniProt: A2ZYY3 Q5N760
LinkDB
Position
1:complement(34652131..34655483)
AA seq 279 aa
MDLLHGESVQTTVAIAVAVVAVAAGGAFLLLRSRKPKGCLDPENFKKFKLVEKKQISHNV
ARFKFALPTPTSVLGLPIGQHISCRGQDATGEEVIKPYTPTTLDSDLGHFELVIKMYPQG
RMSHHFREMKVGDYMSVKGPKGRFRYQVGQVRAFGMLAGGSGITPMFQVARAILENPNDI
TKVHLVYANVTHDDILLKEELDNMAKTYPDRFKIYYVLNQPPEVWNGGVGFVSQDMIKAH
LPAPAEDIQILRCGPPPMNKAMAAHLDELGYTKEMQFQF
NT seq 840 nt   +upstreamnt  +downstreamnt
atggatctcctgcacggggagagcgtccagaccacggtggccatcgccgtcgccgtcgtc
gcggtcgccgcgggcggcgccttcctcctcctccggtccaggaagcccaagggctgtttg
gatcctgagaacttcaagaagtttaaacttgtggaaaagaagcaaataagtcataacgtg
gccagattcaaatttgctcttccaactccaacctctgtattgggccttccaattggtcag
catatcagttgcagaggacaagatgctacaggcgaagaagtaatcaaaccttatacccct
actacattggattctgatctagggcattttgagcttgttattaagatgtaccctcaagga
agaatgtcacaccatttccgtgaaatgaaagttggtgattatatgtctgtgaagggacct
aagggtcgtttcagataccaagttgggcaagtgagagcttttggaatgctagctggtgga
tcaggcatcactcccatgttccaagttgcaagggcaattcttgagaaccctaatgatatc
acaaaagttcatttagtctatgcaaatgtcacgcatgacgacattcttctgaaggaagaa
ctggacaacatggccaaaacctaccctgatcgctttaagatctactatgtcttgaatcag
cctcctgaagtctggaacggtggcgttgggtttgtgtcacaggacatgattaaagctcat
ttgccagcacctgccgaggacattcaaatcttgaggtgtggtcctcctccgatgaacaag
gcaatggctgcgcaccttgatgagctcgggtacaccaaggagatgcagttccagttctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339153
Entry
4339153           CDS       T01015                                 
Name
(RefSeq) NADH--cytochrome b5 reductase 1
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4339153
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     4339153
SSDB
Motif
Pfam: FAD_binding_6 NAD_binding_1 NAD_binding_6 DUF5716_C
Other DBs
NCBI-GeneID: 4339153
NCBI-ProteinID: XP_015637944
UniProt: Q0DH71 Q6AVN1
LinkDB
Position
5:24027775..24030804
AA seq 282 aa
MEFLQGQSTETAVAVAVAVVAVAAGAAFLLLLLRSSKKPKGCLDPENFKEFKLVEKRQIS
HNVAKFRFALPTPASVLGLPIGQHISCRGQDATGEEVIKPYTPTTLDSDLGRFELVIKMY
PQGRMSHHFHEMKVGDYLSVRGPKGRFKYQPGQVRAFGMLAGGSGITPMFQVTRAILENP
SDNTKVHLIYANVTYDDILLKEELDSMVETYPDRFKIYYVLNQPPEIWNGGVGFVSMEMI
QTHCPAPAADIQILRCGPPPMNKAMAEHLENLGYTKEMQFQF
NT seq 849 nt   +upstreamnt  +downstreamnt
atggagttcctgcaggggcagagcacggagaccgccgtggccgtggcggtggccgtcgtc
gccgtggccgccggcgccgccttcctcctcctcctcctccgcagcagcaagaagcccaag
ggctgcttggaccctgagaacttcaaggagtttaagcttgtggagaagaggcagatcagt
cataatgtggccaagttcagatttgctctaccaacccctgcttctgtgctggggcttcca
attggccaacatatcagttgcagagggcaggatgctactggcgaggaagtaatcaagcct
tatactccaactacgctggattctgatcttggacggtttgagcttgttattaagatgtat
ccccaaggaagaatgtctcatcattttcatgagatgaaagttggtgactatttatctgtg
agaggacctaagggtcgcttcaaataccaacctgggcaagtaagagcatttggaatgtta
gctggaggatcaggcattaccccaatgttccaagtcacaagagcaattcttgaaaaccca
agtgacaatacgaaagtgcacttaatctatgccaatgtcacatatgatgacattcttcta
aaggaagaattggatagtatggttgaaacctatcccgatcgcttcaagatatactatgta
ttaaatcagcctccagaaatctggaatggtggtgttgggtttgtgtcaatggaaatgatc
caaacccattgcccggcacctgctgctgacattcagatattgagatgcggacctcctccc
atgaacaaagccatggctgaacacctggagaatcttggctacacgaaggaaatgcagttc
caattctaa

DBGET integrated database retrieval system