KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327131
Entry
4327131           CDS       T01015                                 
Name
(RefSeq) acyl-protein thioesterase 1 homolog 1
  KO
K06130  lysophospholipase II [EC:3.1.1.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4327131
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     4327131
SSDB
Motif
Pfam: Abhydrolase_2 FSH1 Hydrolase_4 Peptidase_S9 Abhydrolase_6 DLH LIP Lipase_3 Abhydrolase_4
Other DBs
NCBI-GeneID: 4327131
NCBI-ProteinID: XP_015631233
UniProt: Q94E46
LinkDB
Position
1:complement(3846248..3850266)
AA seq 257 aa
MSSFGGTSSVASGGGKRLEYGRTHVVRPKGAHKATIVWLHGLGDNGASWSQLLETLPLPN
IKWICPTAPTRPVAVFGGFPSTAWFDVADLSEDAPDDVEGLDASAAHVANLLSTEPADIK
LGVGGFSMGAATALYSATCYAHGKYGNGNPYPVNLSVSVGLSGWLPCARSLKNKIESSQE
AAQKASSIPLLLCHGKADDVVLYKHGEKSADALKTTGFSNVVFKSYNRLGHYTVPEEMDE
VCKWLTANLGVSSSSSA
NT seq 774 nt   +upstreamnt  +downstreamnt
atgagcagcttcggcggcaccagctccgtcgcctccggtggtgggaagaggctcgagtac
gggcggacgcatgtcgtgaggcccaagggcgcgcacaaggccaccatcgtctggctccac
ggcctcggggacaacggagccagctggtctcaactactggaaacccttccccttcccaat
ataaaatggatttgccccaccgcgcctacaaggccagtggcagtttttggtgggttccca
tcaactgcatggtttgatgttgctgatctttcagaagacgctcctgatgatgttgagggg
ttggatgcctcagctgcacatgttgcaaacttattatcaactgagccagctgacatcaaa
cttggtgttggtggctttagcatgggcgcagctaccgccctttactctgcaacctgctat
gctcatggaaaatacggaaatggcaatccatatcctgtgaacttaagtgtgtctgttggt
ctcagtggctggcttccttgtgccaggtctttgaagaacaaaattgaaagctcacaggag
gctgcacaaaaggcttcatccatacctcttttgctttgtcatggaaaagctgatgatgta
gttctctacaagcatggtgagaaatctgctgacgcactgaagacaactggattttcaaat
gtggtgttcaagtcctacaacagacttggacactacactgttccggaggagatggatgaa
gtctgcaaatggctcaccgcgaacttgggggtcagcagctcatcgtcggcttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335072
Entry
4335072           CDS       T01015                                 
Name
(RefSeq) acyl-protein thioesterase 1 homolog 1
  KO
K06130  lysophospholipase II [EC:3.1.1.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4335072
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     4335072
SSDB
Motif
Pfam: Abhydrolase_2 FSH1 Hydrolase_4 Abhydrolase_6 Esterase_PHB Peptidase_S9 DLH LIP Abhydrolase_4 Lipase_3 Cutinase
Other DBs
NCBI-GeneID: 4335072
NCBI-ProteinID: XP_015636769
UniProt: B7F8C9 A0A8J8Y9X4
LinkDB
Position
4
AA seq 254 aa
MSYYGSSSSGGWGSRRVEYGRTYIVRPKGRHQATIVWLHGLGDNGASWSQLLDSLSLPNI
KWICPTAATRPVTAFGGFPCTAWFDVEDISVDGRDDIEGLDASAAHIANLLSSEPPDVKL
GIGGFSMGAAAALHSAACYAHGKFANSMPYPITLSAVISLSGWLPCSRTLRSKTESSHMA
ARRASSLPILLSHGRVDEVVSYRNAERSVDTLRNSGFLYLNFKSYNGLGHYTIPEEMDDV
GKWLSSRLGLDRSR
NT seq 765 nt   +upstreamnt  +downstreamnt
atgagctattatggaagcagctcttctggtggatggggcagtcggagagtcgagtatggg
aggacctatatagtgaggccaaagggaaggcaccaagccaccattgtgtggctccatggt
ctaggtgacaatggtgcaagctggtcccagctcctggattctctttcattgccaaatatc
aagtggatttgcccaactgcagcaacccggcctgtcacggcattcggcggattcccttgc
actgcgtggtttgatgtggaggacatttcagtggatggccgtgatgacattgaaggactg
gatgcttcagctgcacatattgcaaacctgttgtcgtcagagccacctgacgtgaagctt
gggatcggcggtttcagcatgggtgcagctgctgccctccactccgcagcgtgctacgct
cacggcaaattcgcgaatagcatgccatatccaatcacactcagtgcggtcatcagcttg
agtggctggctcccttgctccaggaccctgaggagcaagacggagagctcacacatggct
gcaagaagagcttcctccttgcctatcttactaagtcatggaagagtggatgaggttgta
tcctacaggaatgctgagagatcagtcgacactctgcgtaactcggggttcttgtatctg
aatttcaaatcctacaatgggctaggccactataccatccctgaagagatggacgatgtc
ggcaaatggctcagctcaaggcttggcctcgacagatcacgctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337344
Entry
4337344           CDS       T01015                                 
Name
(RefSeq) probable carboxylesterase Os04g0669500
  KO
K06130  lysophospholipase II [EC:3.1.1.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4337344
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     4337344
SSDB
Motif
Pfam: Abhydrolase_2 Hydrolase_4 DLH Peptidase_S9 FSH1 Abhydrolase_3 AXE1 Abhydrolase_1 PE-PPE
Other DBs
NCBI-GeneID: 4337344
NCBI-ProteinID: XP_015635942
UniProt: Q0J969
LinkDB
Position
4:complement(34148110..34150712)
AA seq 266 aa
MSSRLRFLFSLAAAIAAASLLAAALRRRAPPSGLAARLVPAPMAAAAARNRSFVLWLHGL
GDSGPANEPIRNFFSAPEFRLTKWAFPSAPNSPVSCNHGAVMPSWFDIHELPMSSGSPQD
DSGVLKAVENVHAMIDKEVADGIPPENIFVCGFSQGGALTLASVLLYPKTLGGGAVFSGW
LPFGSSVTERISPEARKTPILWSHGIADNVVLFEAGQAGPPFLQNAGFSCEFKAYPGLGH
SISKEELYSLESWIKNHLKASQEKEN
NT seq 801 nt   +upstreamnt  +downstreamnt
atgagtagccgcctccgcttcctcttctccctcgccgccgccatcgccgcagcctccctc
ctcgccgccgccctccgccgccgcgcgccgccctccggcctcgccgcccgcctcgtcccc
gcgcccatggcggcggcggcggcccgcaaccggagcttcgtgctgtggctgcacggactc
ggcgactccggcccggccaacgagcccatccgcaacttcttctccgcgccggagttccgc
ctcaccaagtgggcgttcccctccgccccgaactcccccgtctcctgcaaccatggcgct
gtgatgccttcatggttcgacatccacgagctacccatgagctctggttctccacaagat
gacagtggggttcttaaggctgttgaaaatgtgcacgccatgattgataaggaggtagct
gatggcatccctccagagaacatatttgtttgtggattcagtcaaggaggtgctctcaca
ttagcaagtgttttgctttatcccaagactctaggtggtggcgcagtgttcagtgggtgg
ctgccttttggttcgtcagttactgagaggatttcacctgaagcaaggaagactccaatt
ctgtggtcacatggaatagctgacaatgtagtattgtttgaagctggtcaagctggtcca
ccttttttgcaaaatgctggtttcagttgtgaatttaaggcatatccaggtcttggtcac
tcgatttccaaggaagagctatattctcttgagtcttggatcaagaatcatctaaaggcc
tctcaggagaaggaaaattaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9269686
Entry
9269686           CDS       T01015                                 
Name
(RefSeq) acyl-protein thioesterase 1 homolog 1 isoform X1
  KO
K06130  lysophospholipase II [EC:3.1.1.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    9269686
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     9269686
SSDB
Motif
Pfam: Abhydrolase_2 FSH1 Hydrolase_4 Esterase_PHB Abhydrolase_6 DLH LIP Peptidase_S9 Abhydrolase_4
Other DBs
NCBI-GeneID: 9269686
NCBI-ProteinID: XP_015640254
LinkDB
Position
5:complement(29293513..29299654)
AA seq 254 aa
MSYYGSSSSGGRGGQRVEYGRTYVVRPKGRHQATIVWLHGLGDNGASWSQLLDSLSLPNI
KWICPTAATQPVTAFGGFPCTAWFDVEDTSVDGRDDIEGLDASAAHIANLLSSEPPDVKL
GIGGFSMGAAASLYSAACYAHGKFASGIPYPITLSAVISLSGWLPCSRTLRGKMESSHIA
ARRAASLPILLSHGRADEVVSYRNAERSSDTLRSSGFLYLHFKSYNGLGHYTIPEEMDDV
GKWLSSRLGLDRSR
NT seq 765 nt   +upstreamnt  +downstreamnt
atgagttactatggaagcagttcttctggtggacggggtggtcagagagttgagtacggg
aggacctatgtggtgaggccaaagggaaggcaccaagccaccattgtgtggcttcatggc
ctaggtgacaatggtgcaagctggtcccaactcctggattctctttcattgccaaatatc
aagtggatttgccccaccgcagcaacccagcctgtcacagcatttggtggattcccttgc
actgcatggtttgatgtggaggatacttcagtggatggccgtgacgacattgaaggactg
gatgcttcagctgcgcacattgcaaacttgctgtcgtcagagccgcctgatgtgaagctt
gggattggtggtttcagcatgggtgctgctgcttccctctactcagctgcgtgctatgct
catggcaaattcgcaagtggcatcccctacccaatcacacttagcgcggtcatcagcttg
agtggatggctcccttgctccaggaccctgaggggcaagatggagagctcacacatagct
gcaagaagagctgcctccttgcctatcttacttagccatggaagagcggatgaggttgta
tcctacaggaatgctgagaggtcatctgacactctgcgatcctcggggttcttatatctg
catttcaaatcctacaatgggctaggccactataccatccctgaagagatggacgacgtt
ggcaagtggctcagctcaaggcttggcctcgacagatcccgctaa

DBGET integrated database retrieval system