KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327145
Entry
4327145           CDS       T01015                                 
Name
(RefSeq) proactivator polypeptide-like 1
  KO
K12382  saposin
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    4327145
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4327145
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4327145
SSDB
Motif
Pfam: SapB_1 SapB_2 A2M_recep DUF357
Other DBs
NCBI-GeneID: 4327145
NCBI-ProteinID: XP_015620682
UniProt: A0A0P0UZ41 Q5VQH7
LinkDB
Position
1:3422371..3425514
AA seq 226 aa
MCSIRSFAFVLVLAFSVAVAESRDSFNVLAHKSFPLENKKTGLTSANGKLCQLCEQYSTE
ALFYLQQNETQTEILSILHHACANVGPLKQQCITLVDYYIPLFFLEVSMVTPEKFCESVH
LCRKGTMLRLPSRGDTCGICHHVLVEVLIMLKDPDMQLEIVEIFLKACSKADNYVQQCKK
MVLEYTPLILVKSQKFLETTDVCSTIHACKTGTQASAETMLLSAAS
NT seq 681 nt   +upstreamnt  +downstreamnt
atgtgttccataaggagctttgcttttgtgctggtattagcattttcagttgcagtcgcg
gagagcagagattcatttaatgtattggctcataaaagctttccccttgaaaacaagaag
acagggttaacttcagccaatggaaagctgtgtcaactatgcgagcagtactcaacggaa
gcactgttctacctccaacaaaatgaaacccaaactgagattcttagcatcctccaccat
gcatgcgcaaacgttggacctctaaaacagcagtgcatcactctggttgactactacatt
ccccttttcttcttggaggtttcgatggtaacacctgaaaagttctgtgaatcagtgcat
ctctgcagaaagggaacgatgcttcgcctaccatctcgaggagatacatgcggcatatgc
catcatgttcttgttgaagttcttatcatgctaaaggatcctgacatgcagctggagata
gtcgagatatttctcaaagcatgcagcaaggcagataattatgtacagcagtgcaagaag
atggtccttgaatatacccctttgattctggtgaaatctcagaagtttcttgagacgaca
gacgtctgctctacaattcatgcatgcaaaacggggacacaagcatctgcagaaaccatg
cttctgtctgccgcatcgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349589
Entry
4349589           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC4349589
  KO
K12382  saposin
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    4349589
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4349589
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4349589
SSDB
Motif
Pfam: SapB_1 SapB_2
Other DBs
NCBI-GeneID: 4349589
NCBI-ProteinID: XP_015616826
UniProt: Q2RBF9 A0A8J8XMG6
LinkDB
Position
11:591878..594731
AA seq 245 aa
MDFKVASFLLLLLIVTCGAAQGQGNDFVVLDLKTTEIGEDASPMYKEQIASTKIPVTLLR
SKHSSLCSACENITSEAVNFLSEKQIQDKIRTILHDTCSQTFSFEQKCLETMDSYATLVF
AKIAEIKPAAFCKQYGLCRDMALLSAVKSESTCLFCHHIIDEITSKLKDPDAEFEIIQLL
LKECNKIEGHQQQCKRMVLQYVPLVLVNGEKFLEKNDVCAMIQACDAGKRKALNLFSARK
LVRDA
NT seq 738 nt   +upstreamnt  +downstreamnt
atggatttcaaagttgcttcctttctcctactcctgttaatcgtcacctgcggagctgct
caaggtcaaggcaacgattttgttgtccttgatctaaaaacaactgagatcggggaagat
gctagcccaatgtacaaggagcaaattgcgtcgaccaagatacctgtaactcttctgagg
agcaagcacagctcactgtgctcggcttgtgaaaacatcacaagtgaagctgtcaatttt
cttagtgaaaaacaaatacaagataagataaggacgatccttcatgacacttgttctcag
acattctcctttgagcaaaagtgtcttgagactatggactcctatgcaactcttgtcttt
gcaaaaattgctgagatcaagccagctgcgttctgcaaacagtatggcctctgcagggac
atggctcttttatcagctgttaaaagtgaaagcacatgcttattctgccaccacatcatc
gatgaaattacgtccaaactgaaagatcctgatgcagagtttgagatcattcaattacta
ctcaaggaatgcaacaagattgaaggtcatcagcagcagtgcaagaggatggttctgcag
tacgtaccgctggttctggtgaacggtgagaagttcctggagaagaacgatgtgtgcgca
atgatccaagcctgtgatgcaggcaagaggaaggcactcaacttgttctctgcacggaaa
ttggtgcgtgacgcatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9267024
Entry
9267024           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC9267024
  KO
K12382  saposin
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    9267024
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    9267024
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   9267024
SSDB
Motif
Pfam: SapB_1 SapB_2
Other DBs
NCBI-GeneID: 9267024
NCBI-ProteinID: XP_015619397
UniProt: A0A0P0Y676 B9GBH9
LinkDB
Position
12:628310..630955
AA seq 245 aa
MDFKVASFLLLLLIVTCGAAQGQGNDFVVLDLKTTEVGEDASPMYKEQIALTKIPVTLLR
SKHSSLCSACENITSEAVNFLSEKQIQDKIMTILHDTCSQTFSFEQKCLETMDSYATLVF
AKIAEIKPDEFCKQYGLCRDMALLSAMKSESTCVFCHHIIDEIMSKLKDPDAEFEIIQLL
LKECNKIEGHQQQCKRMVLQYVPLVLVNGEKFLEKNDVCAMIQACDAGKRKAFNLFSARK
LVRDA
NT seq 738 nt   +upstreamnt  +downstreamnt
atggatttcaaagtcgcttcctttctcctactcctgttaatcgtcacctgcggagctgct
caaggtcaaggcaatgattttgttgtccttgatctaaaaacaactgaggtcggggaagat
gctagcccaatgtacaaggagcaaattgcgttgaccaagatacctgtaactcttctgagg
agcaagcacagctcactgtgctcggcttgtgaaaacatcacaagcgaagcagtcaacttt
cttagtgagaaacaaatacaagataagataatgactatccttcatgacacttgttctcag
acattctcctttgagcaaaagtgtcttgagactatggactcctatgcaactctcgtcttt
gcaaaaattgctgagattaagccagatgagttctgcaaacagtatggcctctgcagggac
atggctcttttatcagctatgaaaagtgaaagcacatgcgtattctgccaccacatcatc
gatgaaattatgtccaaactgaaagatcctgatgcagagtttgagatcattcaattacta
ctcaaggaatgcaacaagattgaaggtcatcagcagcagtgcaagaggatggttctgcag
tacgtccctctggttctagtgaacggtgagaagttcctggagaagaacgatgtgtgcgca
atgatccaagcctgtgatgcaggcaagaggaaggcattcaacttgttctctgcacggaaa
ttggtgcgtgacgcatga

DBGET integrated database retrieval system