KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327162
Entry
4327162           CDS       T01015                                 
Name
(RefSeq) ubiquitin-conjugating enzyme E2 5A
  KO
K06689  ubiquitin-conjugating enzyme E2 D [EC:2.3.2.23]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
osa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4327162
   04120 Ubiquitin mediated proteolysis
    4327162
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4327162
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     4327162
Ubiquitin system [BR:osa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   4327162
SSDB
Motif
Pfam: UQ_con RWD UEV
Other DBs
NCBI-GeneID: 4327162
NCBI-ProteinID: XP_015650522
UniProt: Q8S920
LinkDB
Position
1:complement(26781136..26784536)
AA seq 147 aa
MASKRIQKELKDLQKDPPTSCSAGPVGEDMFHWQATIMGPSDSPYAGGVFLVTIHFPPDY
PFKPPKVAFRTKVFHPNINSNGSICLDILKDQWSPALTISKVLLSICSLLTDPNPDDPLV
PEIAHMYKTDRHKYENTARTWTQRYAM
NT seq 444 nt   +upstreamnt  +downstreamnt
atggcgtcaaagaggatacagaaggagctcaaggatctgcagaaggatccccctacatca
tgcagtgcaggtcctgttggtgaagacatgttccactggcaggcaacgataatgggtcca
tctgatagcccatatgctggtggagttttcctagttaccatccacttccctcctgattat
cccttcaaaccacccaaggtggcgtttcgcaccaaggttttccatccaaacatcaacagc
aacgggagcatttgccttgacatccttaaggaccaatggagcccagcactaaccatttcc
aaggtgttgctgtcaatctgttccctgctgactgatccgaaccctgatgatcctctggtc
cctgagatcgcccacatgtacaagacagataggcacaagtacgagaacacagcaaggacc
tggactcagaggtacgccatgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327450
Entry
4327450           CDS       T01015                                 
Name
(RefSeq) ubiquitin-conjugating enzyme E2-17 kDa isoform X1
  KO
K06689  ubiquitin-conjugating enzyme E2 D [EC:2.3.2.23]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
osa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4327450
   04120 Ubiquitin mediated proteolysis
    4327450
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4327450
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     4327450
Ubiquitin system [BR:osa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   4327450
SSDB
Motif
Pfam: UQ_con RWD UEV
Other DBs
NCBI-GeneID: 4327450
NCBI-ProteinID: XP_015634061
LinkDB
Position
1:34916521..34919638
AA seq 156 aa
MQFKQELIMASKRILKELKDLQKDPPTSCSAGPAGEDMFHWQATIMGPPDSPYAGGVFLV
NIHFPPDYPFKPPKVSFKTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTD
PNPDDPLVPEIAHMYKTDRPKYETTARSWTQKYAMG
NT seq 471 nt   +upstreamnt  +downstreamnt
atgcaatttaagcaggagcttatcatggcgtcgaagcggatcctcaaggaactaaaggac
ctgcagaaagatcctccaacatcatgcagtgcaggtcctgctggtgaggatatgttccat
tggcaggcaaccattatgggccctccagatagtccctatgctggtggtgttttcttggtg
aatattcatttccccccggactaccccttcaaacctccaaaggtgtcttttaagacaaag
gtcttccatccaaacatcaatagcaatggaagcatatgcctcgacattcttaaggaacag
tggagccctgctttgacaatatctaaggtcttgctttcgatctgctcgctgctcactgac
cccaacccggacgaccctcttgtccctgagattgcccacatgtacaagacggaccgtcca
aagtatgagacgacagcccgcagctggacccagaagtatgccatgggatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327451
Entry
4327451           CDS       T01015                                 
Name
(RefSeq) ubiquitin-conjugating enzyme E2-17 kDa
  KO
K06689  ubiquitin-conjugating enzyme E2 D [EC:2.3.2.23]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
osa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4327451
   04120 Ubiquitin mediated proteolysis
    4327451
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4327451
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     4327451
Ubiquitin system [BR:osa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   4327451
SSDB
Motif
Pfam: UQ_con RWD UEV
Other DBs
NCBI-GeneID: 4327451
NCBI-ProteinID: XP_015621235
UniProt: Q8L458
LinkDB
Position
1:34937680..34941835
AA seq 148 aa
MASKRILKELKDLQKDPPTSCSAGPAGEDMFHWQATIMGPPDSPYAGGVFLVNIHFPPDY
PFKPPKVSFKTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV
PEIAHMYKTDRPKYETTARSWTQKYAMG
NT seq 447 nt   +upstreamnt  +downstreamnt
atggcatcgaagcggatcctcaaggaactaaaggacctgcagaaagatcctccaacatca
tgcagtgcaggtcctgctggtgaggatatgttccattggcaggcgaccattatgggtcct
ccagatagtccctatgctggtggagttttcttagtgaatattcatttccccccggactac
cccttcaagcctccaaaggtatctttcaagacaaaggtcttccatccaaacatcaatagc
aatggaagcatatgccttgacattcttaaggagcaatggagccctgctttgacaatttct
aaggtgttgctttcgatctgctcgctgctcactgaccccaacccggacgaccctcttgtc
cctgagattgcccacatgtacaagacggatcgtccaaagtatgagacgacagcccgcagc
tggacccagaagtatgccatgggatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337331
Entry
4337331           CDS       T01015                                 
Name
(RefSeq) ubiquitin-conjugating enzyme E2 28
  KO
K06689  ubiquitin-conjugating enzyme E2 D [EC:2.3.2.23]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
osa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4337331
   04120 Ubiquitin mediated proteolysis
    4337331
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4337331
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     4337331
Ubiquitin system [BR:osa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   4337331
SSDB
Motif
Pfam: UQ_con RWD UEV
Other DBs
NCBI-GeneID: 4337331
NCBI-ProteinID: XP_015635592
UniProt: Q7XR79 A0A0P0WG27
LinkDB
Position
4:complement(34087822..34090670)
AA seq 148 aa
MASKRILKELKDLQKDPPTSCSAGPVGEDMFHWQATIMGPSDSPFAGGVFLVNIHFPPDY
PFKPPKVSFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV
PEIAHMYKTDRAKYESTARSWTQKYAMG
NT seq 447 nt   +upstreamnt  +downstreamnt
atggcgtccaagaggatcctgaaggagttgaaggacctgcagaaggaccctcccacctca
tgcagcgcaggtcctgtgggtgaggacatgttccattggcaagctactattatgggaccc
tcagacagcccatttgctggtggggtattcttggtgaacattcatttcccaccggattat
ccttttaaaccaccgaaggtctctttccgcaccaaggttttccacccgaacattaatagc
aatggcagcatttgcctcgacatcctcaaggaacagtggagtcctgcacttaccatatca
aaggtcctcctgtcaatttgttcactgctgacggacccgaaccccgatgatccgttggtg
ccggagattgctcacatgtacaagactgatagggccaagtatgaatccaccgctcgctcc
tggacacagaagtacgccatgggctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341133
Entry
4341133           CDS       T01015                                 
Name
(RefSeq) ubiquitin-conjugating enzyme E2-17 kDa
  KO
K06689  ubiquitin-conjugating enzyme E2 D [EC:2.3.2.23]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
osa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4341133
   04120 Ubiquitin mediated proteolysis
    4341133
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4341133
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     4341133
Ubiquitin system [BR:osa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   4341133
SSDB
Motif
Pfam: UQ_con RWD UEV
Other DBs
NCBI-GeneID: 4341133
NCBI-ProteinID: XP_015644534
UniProt: A3BC59
LinkDB
Position
6:complement(18015520..18017746)
AA seq 148 aa
MASKRILKELKDLQKDPPTSCSAGPVGEDMFHWQATIMGPADSPYAGGVFLVSIHFPPDY
PFKPPKVAFKTKVFHPNINSNGSICLDILKEQWSPALTVSKVLLSICSLLTDPNPDDPLV
PEIAHMYKTDRAKYESTARGWTQKYAMG
NT seq 447 nt   +upstreamnt  +downstreamnt
atggcgtccaagcggatcctcaaggagctcaaggacctgcagaaggatcccccaacctcc
tgcagcgctggccctgtgggagaagatatgttccactggcaagctacgattatgggtcca
gcagatagtccatatgcaggtggcgtcttcttggtttctattcacttccctccagactat
ccgttcaaaccgcccaaggttgcatttaagacaaaggttttccacccaaacatcaacagt
aacggaagcatctgccttgatatcctgaaggaacagtggagccctgcattgacagtgtca
aaggtactcctctcaatttgttctctactgacggacccaaacccagacgacccgctagtt
ccggagattgcgcacatgtacaagactgatcgggccaaatatgaatcaactgcgaggggc
tggacccagaaatatgcaatgggctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346639
Entry
4346639           CDS       T01015                                 
Name
(RefSeq) ubiquitin-conjugating enzyme E2-17 kDa
  KO
K06689  ubiquitin-conjugating enzyme E2 D [EC:2.3.2.23]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
osa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4346639
   04120 Ubiquitin mediated proteolysis
    4346639
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4346639
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     4346639
Ubiquitin system [BR:osa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   4346639
SSDB
Motif
Pfam: UQ_con RWD UEV
Other DBs
NCBI-GeneID: 4346639
NCBI-ProteinID: XP_015651397
UniProt: A3BX13 Q69JN7
LinkDB
Position
9:6947844..6950914
AA seq 148 aa
MASKRIQKELMDLRKDPPTSCSAGPAGEDLFHWQATIMGPSDSPYAGGVFFVNIHFPPDY
PFKPPKVNFQTKVYHPNINSNGSICLDILKEQWSPALTISKVLLSISSLLTDPNPDDPLV
PEIAHVYKSQRPRYEETARAWTQKYAMG
NT seq 447 nt   +upstreamnt  +downstreamnt
atggcaagcaaaaggattcagaaggaactcatggatttgcggaaggatccaccaacatca
tgcagtgctgggcctgcaggagaggatttattccattggcaggccacaatcatgggccct
agcgacagcccctacgctggtggggtgttctttgttaacatccatttcccccctgactac
ccttttaagcctccaaaagtgaacttccaaacaaaggtgtatcacccaaacatcaactcc
aatggaagcatttgccttgacatcctcaaggagcagtggagcccagcattgaccatatca
aaggtcctcctatccatcagctctcttctcactgaccccaacccagatgatccccttgtc
ccagagatcgcccacgtctacaagagccagaggccacgttatgaggagacggcgagggcc
tggacccagaaatacgcaatgggttag

DBGET integrated database retrieval system