KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327164
Entry
4327164           CDS       T01015                                 
Name
(RefSeq) putative glucose-6-phosphate 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4327164
Enzymes [BR:osa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     4327164
SSDB
Motif
Pfam: Aldose_epim T2SS-T3SS_pil_N
Other DBs
NCBI-GeneID: 4327164
NCBI-ProteinID: XP_015650491
UniProt: Q0JKP9 A0A0P0V655
LinkDB
Position
1:complement(26791764..26795996)
AA seq 314 aa
MSMGHYSEQRPGFEVTKDWNGADQVMIRSPRGASVLVSLHGGQVVSWRNDRGEELLFTSS
KAIFKPPKAMRGGIPICFPQFGNCGTLEQHGFARNRLWAIDDEAPPLNHNDNNGKVSVDL
LLKPSEDDLKCWPHCFEFRLRVSLSTDGDLSLVSRVRNVNGKPFSFSFAYHTYLSVSDIS
EVRIEGLETLDYLDNLSQRERFTEQGDAITFESEVDRVYVGSPSVIAVLDHEKKRTFIVR
KEGLPDVVVWNPWDKKSKTMADFGDEEYKQMLCVDAAAVERAITLKPGEEWTGKLELSAV
ASTNCSDHLDYPCS
NT seq 945 nt   +upstreamnt  +downstreamnt
atgagcatggggcattactccgagcagaggccggggttcgaggtgaccaaggactggaac
ggcgccgaccaggtcatgatccggtcgccgcggggggcgtccgtcctggtcagcctgcac
ggcgggcaggtcgtctcctggaggaacgaccgcggcgaggagctcctcttcaccagcagc
aaggctatcttcaagccaccaaaagcgatgcgaggtggaattcccatatgctttccacag
tttggaaattgtggaacattggagcagcatggatttgcaaggaacaggctatgggccata
gatgatgaggctccaccactaaatcataatgataacaacggcaaagtttctgttgacctt
ctgttaaagccatctgaagatgatctcaaatgttggccacactgctttgaattccgtctc
agagtttctctttcgacggatggagatctctcgttagtatcacgagtcaggaatgttaat
gggaagccattcagtttttcgtttgcttaccatacatatctttcagtctctgacatcagt
gaggtgagaatagaaggtctggagacacttgattatcttgacaaccttagccaaagagaa
cgttttacagaacaaggagatgctataacatttgagtctgaggttgacagagtctacgtt
ggttccccaagcgtaattgctgtgcttgaccatgagaagaaacgcaccttcattgtaagg
aaagaagggcttcctgacgtcgttgtttggaacccatgggacaagaagtcgaaaacgatg
gcggattttggcgacgaggagtacaagcagatgctgtgtgtggacgctgccgcagtcgag
cgagccatcacgctgaagccaggcgaggagtggacggggaagctggagctgtccgccgtc
gcttccaccaactgcagcgaccatctggactacccttgtagctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328481
Entry
4328481           CDS       T01015                                 
Name
(RefSeq) putative glucose-6-phosphate 1-epimerase isoform X1
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4328481
Enzymes [BR:osa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     4328481
SSDB
Motif
Pfam: Aldose_epim TrkA_N
Other DBs
NCBI-GeneID: 4328481
NCBI-ProteinID: XP_015624081
UniProt: A0A8J8YS63 B9F3C8
LinkDB
Position
2:complement(4220546..4223826)
AA seq 316 aa
MAGGVSSVEVVKDGATGLEKLVLREAHGCSVQVFLYGGQVIFWENEYREQLLFVSRKAYF
KPPKAIRGGIQICFPQFGNHGVLEQHGFARNRLWSVDETPPPFPATTSNCHIDLILKQSP
EDLKIWPHSFEFRLRVALSPTGDLMLTSRIKNTNADGKPFKFGFSYNTYFSVSDISEVRV
EGLETLDYIDNLQCGKRCTEQGDAVVFESEAEKVYLSAPPKIVIIDHDKKRTFELRKEGL
PDVVVWNPWDRKAKTILDFGEEEYKCMLCVGAANAEKPITLRPGEEWQGRQEISVVPSSY
SSGQWDPEIIHRIQDI
NT seq 951 nt   +upstreamnt  +downstreamnt
atggccggcggggtgtcgtccgtggaggtcgtgaaggacggcgccactgggctggagaag
ctcgtcctgcgcgaggcccatggctgctccgtccaggtatttctgtacggaggccaagtg
atcttttgggaaaatgaatatcgagaacaactgctctttgttagtagaaaggcttatttc
aaaccaccaaaggctattcgtgggggcatacaaatttgctttcctcaatttgggaaccat
ggagttcttgaacaacatggatttgcaaggaaccgattatggagtgttgatgaaactccc
cctccttttccagctaccacttcaaactgtcatattgacttgatactcaagcagtcccca
gaagatttgaagatctggccgcatagttttgagtttaggctgcgagttgctcttagccct
acaggagatctgatgctcacatctcgaataaaaaataccaatgcagatgggaagccattc
aaatttggattttcatataacacatatttttcagtctctgacatcagtgaagtacgggtt
gagggtttggagaccttggactacattgacaacctgcaatgtggaaaacgttgtactgaa
caaggagatgccgttgtattcgaatctgaagcggagaaggtatatttgagtgctccaccc
aagattgtgatcattgaccatgacaagaagagaacttttgagttaaggaaagagggactt
cctgatgttgttgtttggaacccatgggacaggaaagcaaaaacgatactggattttggg
gaggaagagtacaaatgcatgctatgtgtaggggctgcaaatgctgagaagccaattaca
ttaaggcctggtgaagagtggcaaggaaggcaagagatatctgttgttccatccagttac
agcagcggacaatgggatcctgaaataattcatcggatacaggacatctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337265
Entry
4337265           CDS       T01015                                 
Name
(RefSeq) putative glucose-6-phosphate 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4337265
Enzymes [BR:osa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     4337265
SSDB
Motif
Pfam: Aldose_epim
Other DBs
NCBI-GeneID: 4337265
NCBI-ProteinID: XP_015636734
UniProt: Q0J9E7 Q8S3Q3
LinkDB
Position
4:33557362..33563957
AA seq 344 aa
MSSAASASAAGGAGEEGAAAAAQPQQEGPVVTCKGVNGLDKVVLREVRGSSAEVYLYGGH
VTSWKDEHGEELLFVSNKAIFKPPKAIRGGIPICFPQFSNFGNLDPHGFARNRTWSVEND
PPPFPVPTSNKAYVDLILTHTEEDLKIWPHSYEFRLRVALGPGGDLMLTSRIRNTNADGK
PFSFTFAYHTYFSISDISEVRVEGLETLDYLDNLQERNRYTEQGDAIVFESELDRIYLGT
PSKIAIIDHEKKRTFVVRKGGLPDAVVWNPWDKKAKAMSDFGDDEYKRMVCVEAAAIEKP
ITLKPGEEWTGKLELSAVPSSYYSGQLDPDRVLQDSSVPEDSIS
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgtcgtcggcggcgtcggcgtcggcggccggaggggcaggcgaggagggcgccgccgcc
gccgcgcagccgcagcaggaggggccggtggtgacctgcaagggcgtgaacgggctcgac
aaggtcgtcctccgggaggtccgaggcagctctgccgaggtgtacctgtatggcggccat
gtcacatcatggaaagatgagcatggagaggagctgctttttgttagtaataaggctatt
ttcaaacctccaaaagctatacgtggagggataccaatctgctttcctcagttttccaac
ttcggaaatctggacccacatggctttgcaaggaacaggacctggagtgttgaaaatgat
ccaccaccatttccagtaccaacttctaataaagcttacgtcgatttaatccttacgcat
actgaagaagatctaaagatctggccacatagttacgagttccgtctgagagttgcactt
ggacctggtggagatctgatgctgacttcacgtataagaaataccaatgcagatggaaag
ccattctcatttacatttgcatatcacacatacttttcaatatctgatatcagcgaggtg
cgagtagaaggcctggaaactctggattacctagacaacttacaagagagaaatcgatac
actgaacaaggggatgcaattgtttttgaatctgaattggacagaatatatctgggcaca
ccgtcaaaaattgccattattgatcatgagaagaaaagaacatttgttgtgaggaaaggt
ggccttcctgatgctgttgtttggaacccttgggacaagaaggctaaggctatgtcagac
tttggggatgacgaatataaacgcatggtctgtgtggaggcagctgctatagaaaagccg
attactttgaagcctggtgaggagtggactggaaagttggaactgtctgctgtcccatct
agctattacagtggtcagctggatcctgatcgtgttcttcaggattcaagtgtcccggag
gactcaatcagctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339654
Entry
4339654           CDS       T01015                                 
Name
(RefSeq) putative glucose-6-phosphate 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4339654
Enzymes [BR:osa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     4339654
SSDB
Motif
Pfam: Aldose_epim T2SS-T3SS_pil_N
Other DBs
NCBI-GeneID: 4339654
NCBI-ProteinID: XP_015637492
LinkDB
Position
5:28342089..28345118
AA seq 319 aa
MSMGHYTNLTDPRTELEVVRDWNGVDQVVLRSPRGAYARVSLHGGQVLSWRNDRGEELLF
TSSKAIFKPPKAMRGGIPICFPQFGNSGTLEQHGFARNRIWALDEEHPPLNQNDNNSKAS
VDLILKPSEDDLKCWPHGFEFRLRVSLTKDGNLSLVSRIRNVNGKPFSFSFGYHTYLSVS
DISEVRIEGLETLDYLDNLSQRERFTEQGDAITFESEVDRVYVSSPNVIAVLDHEKKRTF
VIRKEGLPDVVVWNPWEKKSKNIVDFGDEEYKQMLCVDAAAAERQITLKPGEEWTGKLEL
SEVPSTNCSGHLDQPGIII
NT seq 960 nt   +upstreamnt  +downstreamnt
atgagcatggggcactacaccaacctgacggatccgaggacggagctggaggtggtcagg
gactggaacggcgtcgaccaggtcgtgctccgctcgccgcggggcgcctacgcgcgggtg
agcctgcacggcgggcaggtcctctcctggaggaacgaccgcggcgaggagcttctcttc
accagcagcaaggcaatcttcaagccaccaaaggcgatgcgtggtggaatcccgatatgt
tttccacagtttggaaattctggaacattggagcaacatggatttgcaagaaacaggata
tgggccctagatgaggagcatccaccattaaatcaaaatgataacaacagcaaagcttct
gttgaccttatactaaagccatctgaagatgacctgaagtgctggccacatggttttgag
ttccgcctgagagtttctcttacaaaggatgggaacctgtcactagtatcacgcatcaga
aatgttaatggcaagccattcagtttctcatttggttatcacacatatctgtctgtttct
gacatcagtgaggtgaggatagaaggccttgagacacttgattatctcgataatcttagc
cagagagaacgttttacagaacaaggagatgccataacatttgaatcggaggttgaccga
gtctatgttagctcaccaaatgtaatagctgttctggaccatgagaagaaacgcacattt
gtcataagaaaggaaggactgcctgacgttgttgtgtggaatccgtgggaaaagaaatcg
aaaaacatcgtggacttcggcgatgaggagtacaaacagatgctgtgcgttgatgcggct
gcagcggagagacaaatcactctgaaaccgggagaggagtggacagggaagcttgagctt
tctgaagttccatcgactaactgcagtggccatcttgatcaacccggtatcatcatttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346747
Entry
4346747           CDS       T01015                                 
Name
(RefSeq) putative glucose-6-phosphate 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4346747
Enzymes [BR:osa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     4346747
SSDB
Motif
Pfam: Aldose_epim
Other DBs
NCBI-GeneID: 4346747
NCBI-ProteinID: XP_015651451
UniProt: Q6K2P3 Q0J2K6
LinkDB
Position
9:complement(9655451..9659148)
AA seq 319 aa
MAASCALTLPSAISVSVSVSSNSPRRFRRSRRVVAMASVGQKVYAPGVAVSEGNGGLPKI
DLKSPHGSEAEIYLFGACVTSWKVPSGKDLLFVRPDAVFNGQKPISGGIPHCFPQFGPGT
MQQHGFARNMNWSITDSEANEGDPAVTLELKDDSYSRSMWDFSFQALYKVALHSTSLSTT
LKITNTDDKPFSFNSALHSYFSASISGVSVKGLKGCKTLNKDPDPKNPLEGKEEREEVTF
PGFVDCIYLGAPSELTLDNGLGDKIVISNANWSDAVLWNPHLQMEACYKDFVCVENAKIE
TLQLGPNQSWVAEQKIELI
NT seq 960 nt   +upstreamnt  +downstreamnt
atggcggcttcttgcgcgctcaccctcccctccgccatctccgtctctgtctccgtctcc
tccaattcacctcgacggttcaggcgctctaggagggtggtggccatggccagcgtgggg
cagaaggtgtacgcgcccggcgtggcggtctccgagggcaatggcgggctgccaaagatc
gacctcaagtccccgcatgggagtgaggctgaaatttatctatttggagcctgcgtaaca
tcttggaaagtccccagtggaaaagacctcctatttgtcagaccagatgcggtgttcaac
ggccagaaacccatcagtggtggaatcccacattgcttcccccaattcggtcctggtacc
atgcagcagcatggatttgcaaggaacatgaattggtctatcactgattcagaagctaat
gaaggagatccagctgtaactttggaactaaaagatgactcttatagccgttcaatgtgg
gattttagcttccaagctctgtataaggttgcattgcactctacaagcctgtcaacaaca
ctgaaaataacaaatacagacgataagcctttttcatttaactcggcactccacagctat
ttcagtgcttcaatttctggtgtttcagtgaaaggtctcaaaggttgtaagaccctaaat
aaggatcccgatcccaaaaaccctttggaggggaaagaagagagggaagaggtgactttt
ccaggatttgtcgattgcatttaccttggtgcaccgagtgagctcaccctggacaatgga
ttgggtgacaaaattgtgatatcaaatgcgaattggtcagatgcagtgctgtggaatcct
cacttgcagatggaggcttgttacaaagattttgtctgtgttgaaaatgcaaagattgaa
acattacaactggggccgaaccaatcttgggtggcagagcagaaaattgaactgatatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9268618
Entry
9268618           CDS       T01015                                 
Name
(RefSeq) putative glucose-6-phosphate 1-epimerase isoform X1
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    9268618
Enzymes [BR:osa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     9268618
SSDB
Motif
Pfam: Aldose_epim
Other DBs
NCBI-GeneID: 9268618
NCBI-ProteinID: XP_015636905
UniProt: Q7XSR8
LinkDB
Position
4:30433167..30438322
AA seq 325 aa
MATASWPPTPRSPRPQAPSVERAKGPSGLDKVVLREARGFSAEVHLYGGQVTSWKNDRGD
ELLFVSSKATFKPPKAIRGGIPICFPQFGTHGILEKHGFARNRFWAIDDNPPPFPTSTAA
KAFVDLILKTSEEDLKIWPHSFEFRLRVALGPGGDLALTSRIRNTNTDGRPFSFTFAYHT
YFSVSDISEVRIEGLETLDYIDCLRGKERSTEQGDAIVFESEVDKIYLDAPAKIAIIDHE
KKRTFVLRKDGLPDAVLWNPWDKRTKNMQDFGDEEYKHMLCVEPAAVEKPITLKPGEEWK
GKMDLSAVPSSYCSGQLDPNKVLQG
NT seq 978 nt   +upstreamnt  +downstreamnt
atggccaccgcctcctggccgccgacgcccaggtctccgcgaccgcaggcgccgtccgtg
gagcgcgccaagggcccctcaggcctcgacaaggtcgtgctccgcgaggcgcggggattc
tccgcggaggtccatttatatggaggtcaagtgacctcttggaagaatgaccgtggggat
gaattactttttgtaagcagcaaggccactttcaagcctccaaaagcaatccgtggtggc
atacccatttgcttcccccaatttggcactcatggaattcttgagaaacatggatttgca
aggaatcggttctgggctattgatgataatcctccaccttttccaacaagcactgctgct
aaagcttttgttgatcttattctgaagacttctgaagaagatctcaagatatggcctcat
agctttgaattccgattaagagttgctcttgggcctggaggagatttggctctcacttct
cgaataaggaacaccaacactgatggaagaccattctcatttacatttgcataccacacg
tacttctctgtatctgacataagtgaagtgcgcattgaaggcttggagacactggactac
attgactgtctgaggggaaaagagcgatccacagagcaaggggacgctattgtgttcgaa
tcagaggttgacaaaatatatctagatgcaccagcaaaaattgcaatcattgatcatgag
aagaaacggacatttgtcttaaggaaagacgggcttccagatgctgttttgtggaaccca
tgggacaagaggacaaaaaacatgcaagactttggggatgaagaatacaaacatatgttg
tgtgttgaacctgcagccgttgagaagcccattaccttgaagcctggcgaagagtggaaa
ggaaaaatggatctctccgcagttccttccagttactgtagcgggcagttagatccaaat
aaggttcttcaaggctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9269126
Entry
9269126           CDS       T01015                                 
Name
(RefSeq) putative glucose-6-phosphate 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    9269126
Enzymes [BR:osa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     9269126
SSDB
Motif
Pfam: Aldose_epim
Other DBs
NCBI-GeneID: 9269126
NCBI-ProteinID: XP_015648146
UniProt: B9FZS9 Q6Z3M0
LinkDB
Position
8:complement(8589038..8594479)
AA seq 337 aa
MAAPPPSSPSPPPAAAAAATQQTQPHPQTPFYELVKGNSGIEKVLLRGTRGFSAEVYLYG
AQVTSWKNDHAEELLFVSSKAIFKPPKAIRGGIPICFPQFGTHGNLEQHGFARNRLWTID
DNPPPLPVNPAIKSFVDLILRPSDEDLKIWPHSFEFRLRVALGPNGDLSLTSRIRNTNTD
GRSFSYTFAYHTYFSVSDISEVRVEGLETMDYLDNLKGKERFTEQGDAIVFESEIDKVYL
AAPSKIAIIDHEKKRTFVLTKEGLPDAVVWNPWDKKAKAMQDFGDGEYKHMLCVEPAAVE
KPITLKPGEEWKGRLALSAVPSSYCSGQLDPLKVLQG
NT seq 1014 nt   +upstreamnt  +downstreamnt
atggccgccccgccgccttcctccccgtcgccgccgccggcggcggcggctgcggcgacg
cagcagacgcagccgcacccgcagacgccgttctacgagctcgtcaagggaaactccggc
atcgagaaggtccttctccgcggcacgcgcggcttctccgctgaggtctatctttatgga
gctcaagtaacctcatggaagaatgaccatgcggaggagttgctttttgtcagcagtaag
gctattttcaaacctccaaaagccattcgtggtgggatacccatttgcttcccccaattt
ggaacacatggaaatcttgaacaacatggatttgcaaggaaccgattatggactattgat
gataatccaccacctttaccagtaaaccctgctattaaatcttttgttgatctgattctg
aggccttctgacgaggatttaaagatctggcctcacagttttgagttccgcttgagagtt
gctcttggtcctaatggggatttgagtctcacttctcgaattaggaataccaacactgat
ggaagatctttctcttacacatttgcatatcacacatacttctctgtctctgacatcagt
gaagtgcgtgttgaagggctggaaacaatggactaccttgacaatttgaagggaaaggag
cgttttacagagcaaggggatgctattgtatttgaatcagagattgataaggtatacctt
gctgcaccttcaaaaattgcaattattgatcatgaaaagaaaaggacatttgtcttgaca
aaagaaggacttccagatgctgttgtttggaacccttgggacaagaaggcaaaagctatg
caagattttggagatggagaatacaaacacatgctttgtgtggagcctgcagctgttgag
aagcctattactctgaagccaggtgaagagtggaaaggaagacttgcactctcagctgtt
ccttccagttactgtagtgggcagttagatccattgaaggtccttcaaggttga

DBGET integrated database retrieval system