KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327195
Entry
4327195           CDS       T01015                                 
Name
(RefSeq) clathrin interactor EPSIN 1 isoform X1
  KO
K12471  epsin
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4327195
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4327195
Membrane trafficking [BR:osa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    4327195
SSDB
Motif
Pfam: ENTH ANTH
Other DBs
NCBI-GeneID: 4327195
NCBI-ProteinID: XP_015620330
UniProt: B9EZL2 Q5JNC7
LinkDB
Position
1:30832768..30836731
AA seq 628 aa
MDFRKVLDQTVREIRREVNLKVLKVPEIEQKVLDATSDEPWGPHGSDLADIARATKSYGD
SEIIMNVLWQRLGNTLANWRHVYKALAVIEYLLANGTERAADGIVDNSSRIAKLTRFEYL
EPNGKDVGLNVRKKAEAVLAILDDREKLQEVREKAAVTRDKYFGLSSTGITHKSSAASFG
SGSYSSGSHYGSTGGSREVGSFKDIHTGTEWKKNKKETVSNYSSNREGSKEITNSATSYK
SKKSERHGRRNQNSLTLHSKLSANISTTSEAPSSKKGENEDDDDFNPRGFSTSTGTGTTR
SNHLDLFGPSLMDDLVDSTTSTSTATPNVSTPAVPEVDLFADAAFQSANAPLEAATVSHT
QDKIDLFAGRLSSADSFTSDTEFSVRGSPNKSSEKKMSSVVHPSTSAFDPFKQSFATSFP
SDSEFSVHDPTSKSSQGKTPTPEHSSTAAFDPFAAIPLKSFDGSESFGTFSSNTASNITE
LPRDSSGGPKSSDHGPLEDANFDAFTSHLGSSTTSATESMNKPIKKLGQDSMSASKSVAK
KETFQVKSGIWADSLSRGLIDLNITSSQKKVDLSDVGIVGPLSGGSEDKGPGATMGTAPG
LVSSSFPSKTETSSGSGHFQHQQFGSFK
NT seq 1887 nt   +upstreamnt  +downstreamnt
atggatttcaggaaggtgctcgaccagaccgtccgggagataaggagggaggtaaatctt
aaggtgctcaaggtgccggaaatcgagcagaaggttcttgatgccaccagcgacgagccg
tgggggccgcatggttccgatttggcagatatcgccagggccaccaagagctacggtgat
agcgaaattataatgaatgtgttatggcaacgcctggggaacacacttgcgaattggcgt
cacgtgtataaggcgttggctgtgatcgagtaccttctagctaatggcaccgaacgtgca
gctgatggcattgttgacaatagctcacgaattgcaaaactcacaagatttgagtatttg
gagcctaatggaaaagatgttgggctcaatgtgcgtaagaaggctgaagctgttctagca
attttggatgacagggagaagcttcaagaggtcagagagaaggctgccgttactagagac
aagtattttggcttatcatcaactggaataacgcacaaatcgagcgcagcatcatttggc
agtggcagctactcatctggtagccactatgggagcacaggaggttcaagggaggtggga
tcattcaaggatatacacacaggcacagaatggaaaaagaacaagaaggaaacagtgtca
aactacagcagcaatagagaagggtctaaagaaattactaacagtgcaaccagttataag
tcaaaaaagagtgaaaggcatggtagaagaaatcaaaattccttaacattacactcgaag
ttatctgcaaatattagcaccacatctgaagccccaagctcaaagaaaggggaaaatgag
gatgatgatgatttcaacccacgaggattttctacatctactggaacaggtaccacaaga
tctaatcacctggatctctttggtccaagcttgatggatgatcttgttgattctactaca
tccacttcaacagcaacgccaaatgttagcacacctgctgtgccagaggttgatttattt
gcagatgcagctttccaatcagccaatgctccattggaggcagcaacggtttctcacact
caggacaaaattgatttgtttgctggcagactgtcttctgctgattcatttacttcagac
acagagttctcagtacgcggtagtcctaacaagtcatcggagaaaaaaatgtcttccgtt
gtgcatccttctacttctgcttttgatcccttcaaacaatcttttgccacctcatttcct
tcagattcagagttctcagttcatgatccgacaagcaaatcttctcaaggaaaaactccc
acaccagaacattcaagtacagcagcttttgatccttttgctgcaattccactgaagagt
tttgatggatccgaatcttttggaacattttcttcgaacacagcctcaaacattactgaa
ctgccacgggattcttctgggggtcccaaaagttctgaccatggtcctttggaggatgcc
aattttgatgccttcacttcacacttgggatcttccacaacaagtgcaactgagtccatg
aataagcccatcaaaaagcttgggcaggactcgatgtcagcatcaaaatcagttgcaaag
aaagaaacttttcaggtcaaatctggcatatgggctgactctttgagccgaggattgatt
gatttgaatataacttcgtcacaaaagaaggtcgatctctccgatgttgggattgtcgga
ccgctgagcggcggatctgaggataaaggcccgggggcgacgatgggcacagcaccaggc
cttgtcagttctagttttccatctaaaacagaaacatccagtggaagcggtcattttcag
caccaacagtttggaagctttaagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336871
Entry
4336871           CDS       T01015                                 
Name
(RefSeq) clathrin interactor EPSIN 1
  KO
K12471  epsin
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4336871
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4336871
Membrane trafficking [BR:osa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    4336871
SSDB
Motif
Pfam: ENTH ANTH
Other DBs
NCBI-GeneID: 4336871
NCBI-ProteinID: XP_015635407
UniProt: Q7XTR7 B9FCA6
LinkDB
Position
4:30271211..30276254
AA seq 594 aa
MDFVKVFDQAVREIKREVNLKVLKVPELEQKVLDATSDEPWGPHGTTLSELSHATKKFAE
CQMVMSVLWTRLSERGSKWRHVYKALTIIEYLIANGSERAVDDILDHYSKISVLSSFEYV
EPNGKDAGINVRKKVETILGLINDKEKIKSVREKAASNRDKYVGLSSTGITYKSSSASFG
SNYSSGERYGSFSGTREGDSYGDSYRDKEPVKSSPSYTGSQKSGSRIKKDVNRRNEDSPS
SLKSNAKGNEDDFDDFDPRGSSSNGAANTNTSGVDLFAPNLLDDFIDVPAAATHETNDSA
DAQVDLFADADFQSAIPSTETAAGSDVQGNVDLFAEQPAFTAAFPPQTGFIPPPSSGTSE
ANTSTSKNTTPEPFDPFGAIPINSFDGSDPFGAFNSDVGSSSIPPPTQSSVGNISTPSQN
PQAASDFGGFVSSTVETAAKDPFDFSSSNLGKTPLADPKADASDFGAFVSHSEEVAKDPF
DLSLSTSSGRTNQAPLAAPKSDTKKENFQVKSGIWADSLSRGLIDLNITGPKKVNLADVG
IVGGLDDGSDDKALPSWTMGAGGSSLGMSGIPSSTQSGGIESLANYNKYQFGFK
NT seq 1785 nt   +upstreamnt  +downstreamnt
atggatttcgtgaaggttttcgatcaggccgtgcgggagataaagagggaggtcaatttg
aaggtgctcaaggttccagagctcgaacagaaggtacttgatgcaacaagcgatgaacct
tggggccctcatggtactactctttcagagctatcacatgccaccaagaagttcgctgaa
tgtcagatggtaatgagtgtcctctggactaggctgtctgagcgaggctcgaaatggcgt
cacgtgtataaggctttgacaattattgagtacttaatagccaatggttctgagcgggca
gttgatgacattcttgatcactattcaaagatctcggttctttcaagttttgaatatgtg
gaacctaatggaaaagatgctggaataaatgtgagaaagaaagtcgaaactatattggga
ctcataaatgacaaggagaaaataaagtctgtaagagagaaagccgccagtaatcgtgac
aagtatgttgggctatcatcgacagggataacatataagtcaagctctgcttcatttggt
agcaactatagttctggtgaacgttatgggagttttagtggtacaagggaaggtgattca
tacggtgacagttatagggataaagaacctgttaaatcctctccaagttatactggcagc
cagaaatctggcagcaggataaaaaaggatgtgaatagaaggaatgaggattcaccgagc
tccttgaagtctaatgcaaaaggcaatgaggacgattttgatgattttgatcctcgtgga
tcttcttcaaatggtgcagctaatacaaacaccagtggcgtggatctttttgccccaaac
ttattggatgatttcatcgatgtgcctgcagcagcaactcatgaaacaaacgactctgca
gacgctcaggttgatctgtttgctgatgcagatttccaatcagcaataccaagtacagaa
acagctgcgggttcagatgtccagggcaatgtagacctttttgcggaacagccagccttc
acagcagcctttccaccacagacagggtttattccaccaccaagttctgggacatctgaa
gcaaatacttccacgtctaagaacacaactcctgaaccttttgatccttttggtgctatt
cctataaacagctttgatggatctgatccatttggtgccttcaactccgatgttggatca
tctagtataccaccacccacgcagagttctgttggaaatatcagcacaccaagtcagaac
cctcaagcagcatctgactttggtggctttgtgtcgagcactgtagaaacagcagctaag
gacccctttgatttttcaagtagcaatcttgggaaaacacctttggcagatccaaaggct
gatgcatccgattttggtgcctttgtatcgcacagtgaggaagtagccaaggatcctttt
gatctttctttgagtaccagctctggaaggacaaaccaagcacctctggcggctcccaag
tcagataccaagaaagaaaattttcaggtcaagtctggcatatgggctgactcattgagc
cgtggactgattgatctgaacataactggaccaaagaaggtgaacttagccgacgttggg
attgtcggtggcctcgatgacgggtctgatgataaagctctgccctcatggaccatgggt
gcaggaggttccagcctaggaatgtccggaattccttcatctacacaaagtggtggcatt
gagagcttagctaactacaacaagtaccagtttggctttaaatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346362
Entry
4346362           CDS       T01015                                 
Name
(RefSeq) epsin-3
  KO
K12471  epsin
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4346362
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4346362
Membrane trafficking [BR:osa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    4346362
SSDB
Motif
Pfam: ENTH DUF5329 TMEM131_like
Other DBs
NCBI-GeneID: 4346362
NCBI-ProteinID: XP_015649832
LinkDB
Position
8:28399231..28400987
AA seq 355 aa
MATRWQLLGQASGFLQDKYKQARLALGDVTPAELLVQEATNNDGGVGPDARTLASIADAA
FDMDDYWRIAGVLRRRMARAGDWKEWRPVYKALVVLEFLLTHGPDEVPRDFLPDVAALRD
LRGFTHVDDRGFDWGACMQRRCDSVLSLLTDAERLRDARRRIRVSHSTHELVQQHGSPSS
SSGSPSSASSRTSSQSHASSWSVASSDSPTMVCHCAAAADYRHDKKFDAYTADDDWMQHL
QVHNTTTTLEYDDDHDHDHDCPNHPPLTTPRSWDAHDDHDCPNHPPHTTPRSWDAHVHDL
SLLQRRGRPGTDATFCSRMLGAVNVSSRASGFQSLSQPERRSASKKLQRQLSMEY
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggcgacgaggtggcagctgctggggcaggcgtcggggtttctgcaggacaaatacaag
caagcacggctggccctgggcgacgtgacgccggcggagctgctggtgcaggaggcgacc
aacaacgacggcggagtgggccccgacgccaggaccctggccagcatagccgacgccgcc
ttcgacatggacgactactggaggatcgcgggcgtgctgaggcggaggatggcccgcgcc
ggcgactggaaggagtggaggcccgtgtacaaggctctggtggtgctggagttcctgctc
acccacgggcccgacgaggtcccacgagacttcctgccggacgttgccgccctgcgcgac
ctccgcggcttcacccacgtcgacgacaggggcttcgactggggtgcctgcatgcagagg
cgctgtgacagcgtcctctcgctgctcaccgacgccgaacgcctccgcgacgcacgacgc
cgcatccgcgtctcccactctactcacgagctggtgcagcagcatggttccccttcctcc
tcctcggggtccccctcctctgcttcctcccggacctcctcgcagtcgcacgccagcagc
tggtccgtcgcctcctccgatagccccaccatggtctgccactgtgccgccgccgccgac
taccgccacgacaagaagttcgacgcctacacggcggacgacgactggatgcagcacctg
caggttcacaacaccaccactacgctggagtacgacgacgaccacgaccacgaccacgac
tgcccgaatcatcctcctctcactacaccccgcagctgggacgcccacgacgaccacgac
tgcccgaatcatcctcctcacactacaccccgcagctgggacgcccacgtccacgacttg
tccctgctgcagcggcgcggccgcccaggaacagatgccaccttctgctccaggatgctt
ggcgccgtcaacgtcagcagccgggcatccggcttccagagcttgtcgcagccggaacgg
aggtccgccagcaagaagctccagcgtcagctttccatggaatattga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9268417
Entry
9268417           CDS       T01015                                 
Name
(RefSeq) clathrin interactor EPSIN 2
  KO
K12471  epsin
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    9268417
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    9268417
Membrane trafficking [BR:osa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    9268417
SSDB
Motif
Pfam: ENTH ANTH
Other DBs
NCBI-GeneID: 9268417
NCBI-ProteinID: XP_015625170
UniProt: C7IYF8 Q6K8F1 Q948G6
LinkDB
Position
2:complement(34428659..34434220)
AA seq 945 aa
MKKVFDQTVRDLKREVNKKVLKVPGIEQKILDATSNEPWGPHGSLLAEIAQATQNYHEYQ
MVMNVVWKRINDTGKNWRHVYKGLIVLDYLVAHGTERVIDDIREHSYQISTLADFQYIDS
SGRDQGSNVRRKSQSLVSLVNDKERIQEVRQKALATRDKYRSAFATSGTHRSPGGYDNDR
YEGSYGSRYDNRNGYGGEREYGYRDDDRYGVAGTTPNREGDRYSRDSNEQRYSRDREDEY
KGSHSNHEYAEGSGRRSYGRDRDSYGDDEAYSSRGRQSNADGPTQDERPMERKPSNQQIA
SPPPNYEDVTRDTQDNNHDGRNGGTVPVPVAAAKVSSPPRTSVPPGQVNGVHDNTVEDVP
APPPTHPEVNGFDEFDPRGSVPDTSPPVNPSQAVNSLEMDLFGPDPINSLALVSVPQPTA
SPNVEPSANPGFESNSFMGMPPASTGFNEAFDATNPFGDPTPFKAVHEETPAVSQTNAAP
AGSFHATEPAADANPFQPASAASFGFGDTLGDLSFGSNAAPGQQDIFVPTSSHSEVPPAN
PSVHPEQAVPSYVSSQAPQPAAAGPQTHAAPASFASQAPPTSFASQAPQAGAPYPQAAST
FPHSQASHPAATNPSTIPQNVATPFAPLQMPQPVPSGQSNYFMQPVPGTGINGMSGAPSQ
NGAPSYIPSQASQFAAPTNLQPSQPTFPPQTAMAASQATSISRGASQPLAVPNSMPSGVN
FPLQSSSSAPPETILSALQVSQSEPVKKFESKSTVWADTLSRGLVNLDISGPKANPHADI
GVDFDSINRKEKRQEKKVSQAPVVSTITMGKAMGTGSGIGRAGASAMAPPANPMGASRGI
GMGMGAAGSGYGGGMGMNRPMGMGMGMNQQMGMGMGMNQQAMGMGMNQQAMGMGMNQQPM
GMNMGMGMNQGMGMNMRPPMGMGPGSGYNPMGTGYGGQQPYGGYR
NT seq 2838 nt   +upstreamnt  +downstreamnt
atgaagaaagtattcgatcaaacagtccgggacctaaaaagagaggtgaacaagaaggtc
ctcaaggtgcctggtatagaacaaaagattcttgatgccacaagcaacgagccatggggc
ccacatggatcactcttggcagaaatcgcccaagcaacacaaaattaccatgagtaccag
atggtcatgaatgttgtgtggaagaggatcaatgacactggtaaaaattggcggcatgtt
tataagggattgattgtcctggattacttggttgctcatggtacagagcgagttattgat
gacataagggaacattcttatcagatatcgacactagctgatttccagtatatcgattcg
agtgggagagatcaaggtagcaatgtacggcggaaatcccagagccttgttagtttagtt
aatgacaaagagaggatacaggaagttaggcagaaagcacttgctaccagggacaaatac
cggagtgcattcgccaccagtggaacacacaggagcccaggtggctatgacaatgaccgc
tatgaaggaagctatggcagtaggtatgataacagaaatggctacgggggagaaagagag
tatggatatagggatgatgacagatatggtgttgctggaactactcccaatcgggaagga
gatcgttattctagggattctaatgagcagcgctacagcagagatagagaagatgagtac
aaaggaagtcatagcaaccatgaatatgcagaaggatcaggtcgcaggagctatggacga
gatagggattcatatggggatgatgaagcttattcatcccgtggccggcaaagcaatgct
gacggacctactcaggatgagaggcccatggagcggaagccttctaaccagcagattgct
tcaccaccgccaaactatgaagatgtcacaagagatacacaggataataatcatgatgga
cgaaatggagggactgtgcctgtgccagttgctgcagcaaaggtgtcttcacctccaaga
acaagtgtacccccaggtcaggtgaatggtgtacatgataatactgtggaagacgtacct
gcaccaccacctactcatcctgaagttaatgggtttgacgagtttgatcctcgtggatca
gtaccagatacctcacctccagtgaacccctcacaagccgtgaatagcttggaaatggat
ttattcggaccagatcctattaattcgttggctttggtatctgtgcctcagccaactgcc
agcccaaatgttgagccatcagcaaatccaggatttgagagtaacagttttatgggcatg
ccaccggcttctactggattcaatgaggcctttgatgcaactaatccttttggggatcct
acgcctttcaaggctgttcatgaagaaactcctgcagtttctcagacaaatgctgcacct
gctggttctttccatgctactgaacctgctgcagatgcaaatcctttccagcctgcttca
gcagcaagctttggttttggagacactcttggcgacctctcttttggatcgaatgctgca
cccgggcagcaagatatttttgtgcccacctcatcacattcagaggtaccacctgcaaac
ccatctgtgcaccctgaacaggcagtcccatcttatgtctcctcccaggcacctcagcct
gcagctgctggtccacaaactcatgctgctcccgcttcatttgcttctcaagcacctccc
acttcatttgcttctcaagcacctcaagcaggggcaccctatcctcaggctgcctccaca
tttcctcattcacaagcatctcatcctgcagccactaatccatctacaatccctcagaat
gttgccacaccatttgctcctttacaaatgcctcaacctgtaccatcaggccaatcaaac
tattttatgcaaccagttccagggactggcattaatggcatgtctggggctccttcacag
aatggagcaccatcctacatcccttcacaggcttctcaatttgcagctccaacaaatcta
cagccctctcagccaaccttccccccacaaactgccatggcagcttcacaggcaacatca
atttctcgaggggcatctcagcctcttgcagtgccgaattcaatgccttctggtgtgaac
tttccattacaatcaagttcatcagctccccctgaaacaatcctttcagccttgcaagtt
agtcagtctgagccagtgaagaaatttgagtccaaatctacagtttgggctgatacattg
agccgaggtttagtcaatctggacatctctggaccaaaggctaatccgcacgctgatatt
ggagttgacttcgattcaatcaatcgcaaggagaaaaggcaagaaaagaaagtctctcaa
gctcctgtggtatctacgatcactatgggcaaagccatgggaactggctccggcatcggt
cgggcaggtgcgagtgccatggcacctccagccaacccaatgggtgcaagcaggggcatt
ggcatgggtatgggcgctgctggttccggttacggtggtggaatgggaatgaaccggcca
atgggcatgggaatgggaatgaaccaacaaatgggtatgggaatggggatgaaccaacag
gccatgggaatggggatgaaccaacaggccatgggaatggggatgaaccaacaaccaatg
ggaatgaacatgggcatggggatgaaccagggtatgggaatgaacatgcggcctcctatg
ggaatgggtccaggtagtggatataatccaatgggtaccggatacggagggcagcaacca
tatggtgggtacaggtga

DBGET integrated database retrieval system