KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327196
Entry
4327196           CDS       T01015                                 
Name
(RefSeq) ATP-dependent 6-phosphofructokinase 6 isoform X1
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00030  Pentose phosphate pathway
osa00051  Fructose and mannose metabolism
osa00052  Galactose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
osa03018  RNA degradation
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4327196
   00030 Pentose phosphate pathway
    4327196
   00051 Fructose and mannose metabolism
    4327196
   00052 Galactose metabolism
    4327196
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4327196
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:osa01009]
    4327196
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4327196
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     4327196
Protein phosphatases and associated proteins [BR:osa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     4327196
Messenger RNA biogenesis [BR:osa03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     4327196
SSDB
Motif
Pfam: PFK DAGK_cat NAD_kinase
Other DBs
NCBI-GeneID: 4327196
NCBI-ProteinID: XP_015623816
LinkDB
Position
1:complement(30840128..30845326)
AA seq 492 aa
MSLPDDDAAYAKLEEGDYGYLLDDVPHFTDYLSDLPTFPNPLQDHPAYSTVKQYFVNADD
TVPEKVVVQKDSPRGVHFRRAGPRQRVYFESEDVKACIVTCGGLCPGLNTVIRELVCGLS
HMYNVNDIFGIQNGYKGFYSSNYLPMTPKSVNDIHKRGGTVLGTSRGGHDTKKIVDNIQD
RGINQVYIIGGDGTQKGAYEIYKEIRRRGLKVAVAGVPKTIDNDIAVIDKSFGFDSAVEE
AQRAIDAAHVEASSAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGEGG
LFEYIEKRLKENNHMVIVVAEGAGQDLIAKSIAAADQIDASGNKLLLDVGLWLTHKIKDY
CKNKKMEMTIKYIDPTYMIRAIPSNASDNVYCTLLAHSAIHGAMAGYSFTVGMVNGRHAY
IPFHRVTSTRNKVKITDRMWARLLSSTNQPSFLSQKDIDAAREADKLASKSPVPVNTKEH
GENVKKPANGEK
NT seq 1479 nt   +upstreamnt  +downstreamnt
atgagcctccccgacgacgacgccgcctacgccaagctcgaggagggcgactacggctac
ctcctcgatgacgtcccgcacttcacggactacctctccgatctccccacttttcctaat
ccactgcaagatcatccagcctattcgaccgtcaagcagtattttgtcaatgcagatgat
actgtacctgaaaaggtggttgttcagaaggacagtcccagaggagttcacttccgtcgt
gctgggcctcgtcagagggtgtacttcgagtcagaagatgtcaaagcatgcattgtaacc
tgcggaggcctttgccctgggctaaatacggtcattagagagttggtgtgcggcttgtcc
cacatgtacaatgtcaatgatatcttcggcatacagaatggatacaagggattctattcg
agtaattatcttcctatgacacctaaaagtgtcaatgatatccacaaaagaggtggcaca
gttctgggaacatcacggggtggtcatgacaccaaaaaaattgttgacaacattcaagat
cgtggtattaatcaggtatacatcattggaggggatggaactcagaagggagcatatgaa
atatataaggaaattcgtagacgtggtctaaaagttgctgttgctggtgttcccaagaca
attgataatgatatagcggttatagacaagtcctttggttttgatagtgctgtagaagag
gcccagcgtgccattgatgcagctcatgttgaggcttcaagtgctgagaatggaataggc
ttagttaaactgatgggtcgctatagtgggtttattgcaatgtatgctactcttgcaagc
agagacgtggactgctgcttaattcctgagtcaccattttatttggaaggggagggtgga
ctgtttgagtacatagagaagaggttgaaagagaacaaccacatggttattgttgtagct
gagggagcaggacaggatcttattgccaaaagtatagctgcagcagatcaaatagatgca
tctggaaataagctacttcttgatgttggtctttggctgactcacaagattaaggattac
tgcaagaacaaaaagatggagatgactattaagtatatagatccaacctacatgatccgt
gcaattccaagcaatgcatcagacaatgtctactgcacactgctggcgcacagtgccatt
catggggcaatggctggatatagcttcacagttggaatggtcaatggcaggcatgcatac
attccatttcacagggtaacatcaacaagaaacaaggttaagataaccgacaggatgtgg
gcaaggctgttgtcctcgaccaaccagcccagcttcctgagccagaaggacatcgatgcc
gcaagagaggctgataagctagccagcaaatcgcctgtgccagttaacaccaaggagcac
ggagagaatgtaaagaagccggcaaatggtgagaaatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327301
Entry
4327301           CDS       T01015                                 
Name
(RefSeq) ATP-dependent 6-phosphofructokinase 6
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00030  Pentose phosphate pathway
osa00051  Fructose and mannose metabolism
osa00052  Galactose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
osa03018  RNA degradation
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4327301
   00030 Pentose phosphate pathway
    4327301
   00051 Fructose and mannose metabolism
    4327301
   00052 Galactose metabolism
    4327301
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4327301
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:osa01009]
    4327301
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4327301
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     4327301
Protein phosphatases and associated proteins [BR:osa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     4327301
Messenger RNA biogenesis [BR:osa03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     4327301
SSDB
Motif
Pfam: PFK DAGK_cat
Other DBs
NCBI-GeneID: 4327301
NCBI-ProteinID: XP_015621540
UniProt: Q0JPZ1 A0A0P0UZU8
LinkDB
Position
1:4905506..4909517
AA seq 531 aa
MEAVGVAPAPAGVPEKKLLEVKESRKAAPAAPSTSMAAKWAMKKKLVGGDAGYVLEDVPH
LTDYLPELPTYPNPLQDNPAYSVVKQYFVNTDDTVTQKIVVHKTSARGTHFRRAGPRQRV
YFQSDEVNAAIVTCGGLCPGLNTVIRELVCGLYDMYGVTSVVGIEGGYKGFYSRNTVALT
PKSVNDIHKRGGTVLGTSRGGHDTGKIVDSIKDRGINQVYIIGGDGTQKGASVIYEEVRR
RGLKCSVVGVPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAHVEAESAENGIGVVKLMGR
NSGFIAMYATLASRDVDCCLIPESPFYLEGKGGLLEFIEKRLKDNGHMVIVVAEGAGQDL
IAKSMNFVDTQDASGNKLLLDVGLWLSQKIKDHFKKKRNFPITLKYIDPTYMIRAVRSNA
SDNVYCTLLAHSALHGAMAGYTGFTVAPVNGRHAYIPFYRITEKQNKVVITDRMWARVLC
STNQPCFLSHEDVEHLKHDDDEHHLHNTQLLEGESSPVKDSSKCNGTAAPV
NT seq 1596 nt   +upstreamnt  +downstreamnt
atggaggccgtcggcgtggctccggcccccgcgggggtgccggagaagaagctgctcgaa
gtgaaggagtcccggaaggcggcgccggcggcgccgtcgacgtcgatggcggccaagtgg
gcgatgaagaagaagctcgtcggcggcgacgccgggtacgtgctcgaggacgtgccccac
ctcacggactacctgcccgagcttccgacttacccgaatcctctgcaagacaacccggct
tattcagtcgtcaagcaatacttcgtcaacactgacgacaccgtcacgcaaaagatcgtt
gttcataagaccagtgctaggggcacccatttccggcgagccgggccgcggcagcgggtg
tacttccagtccgatgaggtcaacgcggccattgtcacctgcggtggcctctgccctgga
cttaacactgttatccgcgagcttgtgtgcggcttgtatgatatgtatggcgtcaccagc
gtcgttggcatagagggtggatacaagggtttctattctagaaacaccgtcgcactgaca
ccgaaatcggtgaatgacatccacaagagaggtgggactgttcttggaacctccagagga
ggccatgacaccggcaaaatagttgacagtattaaggatcgcggtattaaccaggtgtat
attattggaggtgatggtacccagaaaggtgcttccgtaatttatgaggaagttcggagg
cgaggcctcaaatgttctgtggttggtgtcccaaagaccatagataacgacattgcggtg
atcgacaagtcctttggttttgacactgcggtggaggaggctcagagggccatcaatgct
gctcatgttgaggctgagagtgcagagaatggcattggtgttgtgaaactaatggggcgc
aacagtgggttcatcgcaatgtatgctactctggctagtcgcgatgtggattgttgctta
atcccagagtctccattctatctagaaggaaaaggtggactccttgaattcatcgagaaa
cggctcaaggacaatggccatatggtcattgtagtggctgagggtgctgggcaagatctc
attgcgaaaagcatgaattttgtggatactcaagatgcttctggaaataagctacttctg
gatgttggcctttggctctcccagaagatcaaggatcatttcaagaagaagcgcaacttc
cccatcactctcaagtacatcgacccgacatacatgatccgtgccgtcaggtcaaacgca
tccgacaacgtctactgcaccctgctagctcacagcgccctccacggcgccatggcgggg
tacaccggcttcaccgtcgcgccggtcaacggcaggcacgcgtatatcccgttctacaga
atcacggagaagcagaacaaggtggtgatcacggacaggatgtgggcgagggtgctgtgc
tcgacgaaccagccatgcttcctgagccacgaggacgtcgagcacctcaagcacgacgac
gacgagcaccacctgcacaacacgcagctcctcgaaggcgagagctcgccggtgaaggac
tcctccaagtgcaacgggacagcagcgccagtgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336113
Entry
4336113           CDS       T01015                                 
Name
(RefSeq) LOW QUALITY PROTEIN: ATP-dependent 6-phosphofructokinase 2
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00030  Pentose phosphate pathway
osa00051  Fructose and mannose metabolism
osa00052  Galactose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
osa03018  RNA degradation
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4336113
   00030 Pentose phosphate pathway
    4336113
   00051 Fructose and mannose metabolism
    4336113
   00052 Galactose metabolism
    4336113
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4336113
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:osa01009]
    4336113
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4336113
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     4336113
Protein phosphatases and associated proteins [BR:osa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     4336113
Messenger RNA biogenesis [BR:osa03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     4336113
SSDB
Motif
Pfam: PFK DAGK_cat
Other DBs
NCBI-GeneID: 4336113
NCBI-ProteinID: XP_015635419
LinkDB
Position
4:23463349..23465727
AA seq 477 aa
MDPTAPNSGDANGGAAADATAPSNTTVTLPPLTLRDVPLLPSAAAATDTIPNPISRHPYF
HPPATFYISPGDVSLRHAFFDLASASPSPLVAYRRAGPRAGVAVDPARARAAVVTCGGLC
PGLNTVLRELVVGLRELYGVRDVFGVAAGYRGFYGPDADHARLDLAAVDDWHKKGGTVLK
TTRGGFDLNKIVDGIVARGYTQVYAIGGDGTMRGAVAIFNEFKRRGLNISITGIPKTVDN
DIGIIDRSFGFQTAVEIAQQAIDAAHVEAVSAVNGIGLVKLMGRSTGHIALHATLSSRDV
DCCLIPEVDFYLEGKGGLFEFLYERIKQKGHAVVVVAEGAGQELIPRTDDQKREQDESGN
IVFLDVGPWLKSELGKWWKREHPSELFTVKYIDPTYMIRAVPANATDNLYCTLLAHSAIH
GIMAGYTGFVPGPINGNYSYIPLEDVAVAKNPVDVNDHKWAWVRSVTNQPDFMKPKY
NT seq 1434 nt   +upstreamnt  +downstreamnt
atggaccccaccgctcccaactccggcgacgccaacggcggcgcggccgccgacgccacc
gccccgtccaacaccaccgtcaccctcccgccgctcaccctccgcgacgtgcccctgctc
ccgtcggcggcggcggcgaccgacacgatccccaacccgatctcccgccacccctacttc
cacccgccggccaccttctacatctccccgggtgacgtctccctccgccacgccttcttc
gacctcgcctccgcgtcgccgtccccgctcgtcgcctaccgccgcgcggggccgcgcgcg
ggggtcgccgtggaccccgcccgcgcgcgcgccgcggtcgtcacctgcggggggctctgc
ccgggcctcaacaccgtcctcagggagctcgtcgtcggcctccgggagctctacggcgtc
cgcgacgtcttcggcgtcgccgccggctaccgcgggttctacggccccgacgccgaccac
gcccgcctggacctggccgccgtcgacgactggcacaagaagggcggcaccgtgctcaag
accacccgtggtggctttgatctcaacaagatcgttgacggcatcgtcgcgcgcgggtat
acgcaggtttatgcaattggaggggatggaacaatgagaggagctgtggccatcttcaac
gagtttaagcgccgtggtttgaacatttctattacagggatcccgaaaactgtggacaat
gatatcggcatcatagacaggtcatttgggttccaaaccgcagtggagattgctcagcag
gcaatcgacgcagcacatgtcgaggctgtgagcgccgtgaatggcattggacttgtcaaa
cttatgggcaggagcacaggccacattgctcttcatgccaccctgagcagccgcgatgtt
gactgctgtttgattcctgaggttgatttctatcttgaaggaaaggggggcctgtttgag
ttcttgtatgaaaggataaaacagaagggacatgctgttgtcgttgttgctgaaggtgct
ggtcaggaattgattccaaggactgacgatcaaaagcgggagcaggacgagtccggcaac
attgtgttccttgatgtgggtccctggttaaaatctgagctgggtaaatggtggaagaga
gaacacccaagcgagttgttcactgtgaagtatatcgatcccacttacatgatacgagct
gttccagcaaatgccactgacaatctgtactgtacattgttggcacattcggcgatccat
gggatcatggctgggtacactggcttcgtccctggcccgattaatggaaactatagctac
ataccgctggaagatgttgctgtggcgaagaacccggtggatgtgaatgatcacaaatgg
gcatgggttagatcagtcacaaaccaaccagatttcatgaagccaaaatactaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338034
Entry
4338034           CDS       T01015                                 
Name
(RefSeq) ATP-dependent 6-phosphofructokinase 6
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00030  Pentose phosphate pathway
osa00051  Fructose and mannose metabolism
osa00052  Galactose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
osa03018  RNA degradation
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4338034
   00030 Pentose phosphate pathway
    4338034
   00051 Fructose and mannose metabolism
    4338034
   00052 Galactose metabolism
    4338034
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4338034
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:osa01009]
    4338034
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4338034
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     4338034
Protein phosphatases and associated proteins [BR:osa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     4338034
Messenger RNA biogenesis [BR:osa03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     4338034
SSDB
Motif
Pfam: PFK DAGK_cat
Other DBs
NCBI-GeneID: 4338034
NCBI-ProteinID: XP_015637629
UniProt: B9FIJ4
LinkDB
Position
5:5813219..5815521
AA seq 542 aa
MEAATVVAAPIPAADAAAKALEKKLLDLELPPFPAPAKKAAAKVVAAAPKKKLAGGAGGY
VLEDVPHLTDYLPNLPSFPNPLQNHPAYSVVKQYFVNADDTVAKKIVVHKGSARGTHFRR
AGPRQRVFFQPDEVSAAIVTCGGLCPGLNTVIRELVCGLHDMYGVTSVVGIEGGYRGFYA
RNTVELTPRSVNGIHKRGGTVLGTSRGGQDTGKIVDSIQDRGINQVYIIGGDGTQKGAAT
IHAEVQRRGLKCAVVGVPKTIDNDIAVIDRSFGFDTAVEEAQRAINAAHVEAESAENGVG
VVKLMGRNSGFIAMYATLASRDVDLCLIPESPFYLEGKGGLLEFAEKRLRENGHMVIVVA
EGAGQDVIARSMRLADAHDASGNKVLLDVGLWLCAKIKDHFKKKANFPITLKYIDPTYMI
RAVPSNASDNVYCSLLAHSAIHGAMAGYTGFTVAPVNGRHAYIPFYRITEKQNKVVITDR
MWARVLCSTNQPCFLSTEDVEKAGQDDEEPIVPLVEGENSLVKAPPLLANAGDRAALCNG
AA
NT seq 1629 nt   +upstreamnt  +downstreamnt
atggaggccgccacggttgtcgctgctccgattccggcggcggatgctgccgccaaggcg
ctggagaagaagctccttgacctggagttgccgccgttcccggcgccggcgaagaaggcc
gccgccaaggtggtcgctgctgctcccaagaagaagctcgccggcggcgccggcgggtac
gtcctcgaggacgtgccccacctcaccgactacctccccaacctcccctccttccccaac
cccctccagaaccaccccgcctactccgtcgtcaagcagtacttcgtgaacgccgacgac
acggtggcgaagaagatcgtggtgcacaaggggagcgcgcgggggacgcacttccggcga
gccgggccgcggcagcgggtgttcttccagcccgacgaggtgtcggcggctatcgtcacc
tgcggcgggctgtgcccgggcttgaacaccgtcatccgcgagctcgtctgcggcctccac
gacatgtacggcgtgacgagcgtggtgggcatcgagggcgggtaccgcgggttctacgcg
cgcaacacggtggagctcaccccgcgctccgtcaacggcatccacaagcgcggcggcacg
gtgctcggcacgtcgcgcggcggccaggacacgggcaagatcgtcgacagcatccaggac
cgtggcatcaaccaggtgtacatcatcggcggcgacggcacgcagaagggcgcggcgacg
atccacgccgaggtgcagaggcgcgggctcaagtgcgcggtggtcggcgtccccaagacg
atcgacaacgacatcgccgtgatcgaccgctcgttcgggttcgacaccgccgtggaggag
gcccagcgcgccatcaacgccgcccacgtcgaggccgagagcgccgagaacggcgtcggc
gtcgtcaagctcatggggcggaacagcggcttcatcgccatgtacgccacgctcgccagc
cgcgacgtcgacctgtgcctcatcccggagtcccccttctacctcgaaggcaagggcggc
ctcctcgagttcgccgagaagcggctgcgcgagaacggccacatggtgatcgtcgtcgcc
gagggcgccggccaggacgtgatcgccaggagcatgcgcctcgccgacgcgcacgacgcg
tcgggcaacaaggtgctcctcgacgtcggcctctggctgtgcgccaagatcaaggatcac
ttcaagaagaaggcgaatttccccatcacgctcaagtacatcgaccccacgtacatgatc
cgcgccgtgccgtccaacgcctccgacaacgtctactgctcgctgctcgcccacagcgcc
atccatggcgccatggccgggtacaccggcttcaccgtcgcacccgtcaatggccgccac
gcctacatccccttctacaggatcacggagaagcagaacaaggtggtcatcacggacagg
atgtgggcgagggtgctctgctcgacgaaccagccgtgcttcctcagcacggaggacgtc
gagaaggcagggcaggacgacgaggagccgatcgtgccgctcgtcgagggcgagaactcg
ctcgtcaaggcgccgccgctgctggccaacgccggcgatcgcgccgccctctgcaacggc
gccgcctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339369
Entry
4339369           CDS       T01015                                 
Name
(RefSeq) ATP-dependent 6-phosphofructokinase 6
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00030  Pentose phosphate pathway
osa00051  Fructose and mannose metabolism
osa00052  Galactose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
osa03018  RNA degradation
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4339369
   00030 Pentose phosphate pathway
    4339369
   00051 Fructose and mannose metabolism
    4339369
   00052 Galactose metabolism
    4339369
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4339369
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:osa01009]
    4339369
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4339369
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     4339369
Protein phosphatases and associated proteins [BR:osa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     4339369
Messenger RNA biogenesis [BR:osa03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     4339369
SSDB
Motif
Pfam: PFK DAGK_cat NAD_kinase
Other DBs
NCBI-GeneID: 4339369
NCBI-ProteinID: XP_015639708
UniProt: Q65X97 A0A0N7KL42
LinkDB
Position
5:26107200..26112457
AA seq 567 aa
MASSHIILPPDDDDEEQRRLEEEEDEDPWARSGPPPAAPEHAMKAALPFSATCVRISRDS
YPNLRALRNASSVSLADAAYVKISEGDFGYVLDDVPHLVDHLPDAPTYPNPLQDHPAYST
VKQYFVNEDDTVPQKVVVQKNSRRGVHFRRAGPRQKVYFESDEVKACIVTCGGLCPGLNT
VIRELVCGLAHMYNVSKIYGIQNGYKGFYSSNYLTLTPKSVDDIHKRGGTVLGTSRGGHD
TKKIVDNIQDRGINQVYIIGGDGTQKGAYEIFKEIRKRGLKVSVAGIPKTIDNDIAIIDK
SFGFDTAVEEAQRAIDSAHVEACSAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPE
SPFYMDGEGGLLQYVERRLKENKHMVIVVAEGAGQDLIAKSLSTSEQQDASGNKLLLDIG
LWLTHKIKDHFKSKKMEMTIKYIDPTYMIRAIPSNASDNVYCTLLAHSAIHGAMAGYSFT
VGNVNGRHAYIPFYRVTSTRNKVKITDRMWARLLSSTNQPSFLSQKDIDEAKENDRTANK
PPLPTGLSHHVANSFDQSASSSSNSQI
NT seq 1704 nt   +upstreamnt  +downstreamnt
atggcgtcctcccacatcatccttccgccggacgacgacgacgaggagcagcgccggctg
gaggaggaggaggacgaggatccgtgggcgcggagcgggcctccccccgcggcgccggag
cacgcgatgaaggcggcgctgccgttctccgcgacgtgcgtgcggatctcccgcgactcc
taccccaacctccgcgccctccgcaacgcctcctccgtcagcctcgccgacgccgcctac
gtgaagatctccgagggggacttcggctacgtcctcgacgacgtgccgcacctcgtcgac
cacctccccgatgcccccacttatcccaatccactacaagatcatccagcctattcaact
gtcaagcaatattttgttaatgaagatgacactgtaccccaaaaggtggtcgttcagaag
aacagccggcggggggttcacttccgtcgtgctggacctcgtcagaaggtttattttgag
tcagatgaagtgaaagcatgcattgtaacttgtggaggcctttgccctggtcttaacact
gtcatcagagagctcgtctgtggtttggcgcacatgtataatgtcagcaaaatctatggt
atacagaatggatacaagggcttctattctagcaattaccttactctgacgccaaagagt
gtcgatgacatccacaagaggggtgggacagttcttggcacatcacgaggtggccatgat
acaaaaaagattgttgacaacattcaggatcgtggaattaatcaggtctatatcattgga
ggagatggaacacagaagggtgcatatgagatcttcaaggaaatccgaaaacgtgggcta
aaggtttctgttgctgggattcccaagacaatagataatgacatagcgatcattgacaag
tcatttggttttgatacggccgtagaagaggcccagcgtgccattgattcagctcatgtg
gaagcttgcagtgctgagaatggaataggcttagtaaaactgatgggccgttatagtggg
ttcattgcaatgtatgctactcttgcaagtcgagatgtggactgctgcttaattccagag
tccccattttatatggatggtgaaggtgggttgcttcaatatgtagagagaaggctgaaa
gagaacaagcacatggttattgttgttgctgagggagcagggcaggatcttatagccaaa
agtttatctacttctgagcagcaagatgcatcaggaaataagctactgcttgatattggt
ctttggctgactcacaagataaaggaccacttcaagagcaaaaagatggagatgactatt
aaatatatagatcctacctacatgatccgagctattccaagcaatgcatcagacaatgtc
tactgcacgctgctggcccacagtgctattcatggtgcaatggccggctatagcttcact
gttggaaatgtcaacggcagacatgcctacatacctttctatagggtgacatccacacgg
aacaaggtcaagatcactgataggatgtgggcgaggctgctatcatcaaccaaccagcca
agcttcctaagccagaaggacatcgacgaagccaaagagaacgataggacggccaacaag
ccaccacttcccaccggcctcagccatcatgtggcaaactctttcgaccagtctgcatca
tcttcgtcgaacagccagatatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340153
Entry
4340153           CDS       T01015                                 
Name
(RefSeq) ATP-dependent 6-phosphofructokinase 3
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00030  Pentose phosphate pathway
osa00051  Fructose and mannose metabolism
osa00052  Galactose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
osa03018  RNA degradation
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4340153
   00030 Pentose phosphate pathway
    4340153
   00051 Fructose and mannose metabolism
    4340153
   00052 Galactose metabolism
    4340153
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4340153
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:osa01009]
    4340153
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4340153
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     4340153
Protein phosphatases and associated proteins [BR:osa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     4340153
Messenger RNA biogenesis [BR:osa03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     4340153
SSDB
Motif
Pfam: PFK DAGK_cat NAD_kinase
Other DBs
NCBI-GeneID: 4340153
NCBI-ProteinID: XP_015642480
LinkDB
Position
6:complement(2678994..2683990)
AA seq 558 aa
MASPPTASASASEAAESGRRSAPGPIDVPSPRDHLHHLLDRRDTPRVVHVEGTTMQRQRG
EAAGDAGAAAAAKPEVKLVTGDGGYVLEDVPHVCDYLPDLPTYSNPLQDNPAYSVVKQYF
VNPDDTVCQKAIVHKDGPRGNHFRRAGPRQRVFFESDEVHACIVTCGGLCPGLNTVIREI
VCGLYDMYGVSRVLGIQGGYRGFYACNTIDLSPKSVNDIHKRGGTVLGTSRGGHDTMKIV
DSIQDRGINQVYVIGGDGTQRGAGVIFEEIRRRGLKVAVAGIPKTIDNDIPVIDRSFGFD
TAVEEAQRAINAAHVEAGSAENGIGLVKLMGRHSGFIAHYATLASRDVDCCLIPESPFYL
EGEGGLFRYLEKRLKENGHMVIVVAEGAGQKLINETKESMGKDASGNSILLDVGLWLSQK
IKEHFKKIKTTINLKYIDPTYMIRAIPSNASDNVYCTLLAHSVVHGAMAGYTGFTVGQVN
GRHCYIPFYRITEKQNKVSITDRMWARLLSSTNQPSFLSKKDVEDAKMEEERASKFFDGP
PPNPKVEDKVASNGKAVK
NT seq 1677 nt   +upstreamnt  +downstreamnt
atggcgtcgcctccaaccgcctccgcctccgccagtgaggccgcggaatccggcaggcgg
agcgcgccggggccgatcgacgtgccgagcccgagggaccacctgcaccacctcctcgac
cgacgtgacacgccgcgggtcgtgcacgtggaggggacgacgatgcagcggcagcgtggg
gaggcggcgggtgacgcgggggcggcggcggcggcgaagcccgaggtgaagctggtgacc
ggggatggcgggtacgtgctcgaggacgtgccgcatgtgtgcgactacctccccgatcta
ccgacatactcaaatccactgcaagataacccggcatactcggttgtgaagcaatacttt
gtaaacccagatgacactgtctgccagaaggccattgttcacaaggatggccctagaggc
aaccacttccgtcgtgctgggcctcgacagagggtgttttttgaatcggatgaggtccat
gcatgcattgtcacatgtggaggactgtgccctggactgaacactgtcattagggaaatt
gtatgtggcttatatgacatgtatggtgtcagtagggtacttggaattcagggtgggtat
agaggtttctatgcttgtaacaccattgacttgagtccaaagagtgtaaacgacattcac
aaaaggggtggaactgttcttgggacatcacgtggaggccatgacaccatgaagattgtt
gacagcatccaggatcgtggtataaatcaggtttatgtaattggtggtgatggtactcaa
aggggtgcaggagtgatttttgaagagattagaagacgtggtctcaaggttgctgttgct
ggcattccaaagacgattgataatgatataccagtaattgacagatcatttggtttcgac
actgcagttgaggaggcccaacgtgcaataaatgctgctcatgtagaagctggaagcgcc
gagaatggtataggcctcgtaaagctaatgggtcgacacagtggttttattgcacactat
gctactctagccagcagagacgtggattgttgcttgattccagagtcacctttctatctg
gaaggtgaaggtggcctttttagatatttggaaaagcgtctgaaggagaatggtcatatg
gttatcgttgttgcggagggtgcagggcagaaacttattaatgaaacaaaggaatcaatg
gggaaagatgcttcaggcaattcgattcttcttgatgttggtctttggttatctcaaaag
ataaaagagcatttcaagaaaatcaagactactataaatctcaagtatatagatcctaca
tacatgatacgtgccattcctagcaatgcatctgacaatgtgtattgcacactgttggca
cacagtgtggttcatggagccatggctggatacactggtttcactgttggccaagtaaat
ggtcggcattgctatatcccgttttacaggatcacagagaagcagaacaaagtttcaatt
actgataggatgtgggcaagacttctctcctcaaccaaccagccaagtttcctcagcaag
aaagatgtggaggacgcaaagatggaagaagagagagcatccaagtttttcgatgggccg
cctcccaaccccaaggttgaagacaaagtcgcttccaatggcaaggctgtgaagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347060
Entry
4347060           CDS       T01015                                 
Name
(RefSeq) ATP-dependent 6-phosphofructokinase 5, chloroplastic isoform X1
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00030  Pentose phosphate pathway
osa00051  Fructose and mannose metabolism
osa00052  Galactose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
osa03018  RNA degradation
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4347060
   00030 Pentose phosphate pathway
    4347060
   00051 Fructose and mannose metabolism
    4347060
   00052 Galactose metabolism
    4347060
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4347060
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:osa01009]
    4347060
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4347060
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     4347060
Protein phosphatases and associated proteins [BR:osa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     4347060
Messenger RNA biogenesis [BR:osa03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     4347060
SSDB
Motif
Pfam: PFK Oxidored_nitro
Other DBs
NCBI-GeneID: 4347060
NCBI-ProteinID: XP_015612071
UniProt: A0A0P0XM93 Q0J1S6
LinkDB
Position
9:complement(14871030..14878205)
AA seq 527 aa
MTFSGMDIALKASTHSSTSQQHWLHSTRYRCQYGLGSTHLNGRKRSPMVLSVRAVSGKSD
LDFSDPSWKEKYQEDWNRRFSLPHITDIYDLKPRLTTFSLKKNRTDGGSLSADKWNGYVN
KDDRALLKVIKYASPTSAGAECVDPDCSWVEHWIHRAGPRKEIYYEPAEVKAAIVTCGGL
CPGLNDVIRQIVFTLEIYGVKNIVGIQFGYRGFFEKGLKEMPLSRKVVENINLSGGSFLG
VSRGGAKTSEIVDSIQARRIDMLFVIGGNGSHAGANAIHEECRKRKLKVSVVAVPKTIDN
DILFMDKTFGFDTAVEEAQRAINSAYIEARSAYHGIGLVKLMGRSSGFIAMQASLSSGQI
DVCLIPEVSFTLDGEHGVMRHLEHLLEKKGFCVVCVAEGAGQDLLQKSNATDASGNVILS
DFGVHMQQKIKSHFKDIGVPADVKYIDPTYMVRACRANASDAILCTVLGQNAVHGAFAGF
SGITSGICNTHYAFLPITEVITKPKRVNPNSRMWHRCLTSTGQPDFH
NT seq 1584 nt   +upstreamnt  +downstreamnt
atgaccttttctgggatggacattgctttaaaagcaagcacacactcttctacatcccag
caacactggttgcattcaaccaggtaccggtgtcaatatggtttgggttccactcacttg
aatggaagaaagagaagtcctatggtactgtctgtaagagctgtttctgggaaatcagac
ttagatttcagtgatccttcttggaaggaaaagtatcaagaagactggaataggcgtttc
agtttgccgcatattacagatatatatgatttgaagccaaggctaactacattctctctg
aagaaaaacaggactgatggtggtagtttatcagcagataagtggaatggctatgtaaat
aaggatgaccgtgcacttctgaaggtgataaagtatgcctcccctacttctgctggagct
gagtgcgtagatcctgactgcagttgggttgaacattggattcatcgtgcagggcctcgt
aaggagatatactatgagcctgcagaagtaaaagctgctattgttacctgtggaggcctc
tgccctggtttaaatgatgtcattagacagatagtatttacattggagatctatggggtt
aagaacattgttggaattcagtttggttatcgtggattttttgagaaaggcttaaaagaa
atgcctctttcacgtaaagtggtggaaaacataaatctttctggtggaagtttcctaggt
gtgtctcgtggaggagctaaaactagtgagatcgtcgatagtatacaagccagaagaatt
gatatgctttttgtaattggtggaaacggtagccatgcaggagctaatgctatccatgag
gagtgtcgtaagagaaaactgaaagtgtcagttgtagcagttccaaagacaattgataat
gatatactattcatggataagacttttggttttgacacggctgtagaagaagctcagcgt
gccatcaattctgcctacatagaggcacgaagtgcatatcatggaattgggttggtcaaa
ttaatgggaagaagtagtgggttcattgccatgcaagcttctctttccagtggacagatt
gatgtctgcctaatacccgaggtatcttttacactagatggagaacatggtgtcatgcga
caccttgaacatttactggaaaaaaagggattttgcgtggtttgtgttgctgaaggtgca
gggcaggatttactgcaaaaatcaaatgcaactgatgcatcaggaaatgtaatacttagt
gactttggtgtccacatgcaacagaagattaagagtcatttcaaggacatcggtgttcca
gctgatgtaaaatacattgatccgacatatatggtccgggcctgtcgtgcgaatgcatct
gatgctatcttgtgcactgtacttggacaaaatgctgttcatggagcctttgccgggttc
agtggtatcacatctggtatttgcaacacgcactacgctttcctcccgatcacagaagtc
atcacaaaaccaaagcgcgtgaaccccaacagcaggatgtggcaccgctgcctcacttcc
actggccaaccggacttccactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347383
Entry
4347383           CDS       T01015                                 
Name
(RefSeq) ATP-dependent 6-phosphofructokinase 2
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00030  Pentose phosphate pathway
osa00051  Fructose and mannose metabolism
osa00052  Galactose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
osa03018  RNA degradation
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4347383
   00030 Pentose phosphate pathway
    4347383
   00051 Fructose and mannose metabolism
    4347383
   00052 Galactose metabolism
    4347383
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4347383
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:osa01009]
    4347383
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4347383
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     4347383
Protein phosphatases and associated proteins [BR:osa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     4347383
Messenger RNA biogenesis [BR:osa03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     4347383
SSDB
Motif
Pfam: PFK DAGK_cat NAD_kinase
Other DBs
NCBI-GeneID: 4347383
NCBI-ProteinID: XP_015611031
UniProt: Q69QS5 Q652D3
LinkDB
Position
9:18411552..18413185
AA seq 465 aa
MDDDGETPMPSLELHKLPTLAGAAIPNPIARHPLYHPSPSFFISPTDVVLRDILFDASPA
SAAGERRRRHVAAYHRAGPRREVAFDPATVRAAIFTCGGLCPGTNTVVRELVVGLSELYG
VRGGVFGVRNGYRGFYSDEVVPLDPAAVEHWHKAGGAALGTSRGGFDLARIVDAIERHGF
NQVYAVGGDGTMRGAARIHREVRRRGRLAVAVAGIPKTVDNDVGVVDRSFGFHTAVEAAQ
QAIAAGHVEAESAANGVGLVKLMGRSAGHIALHATLSSRDVDCCLIPEEDFYLRGAGGLF
DFLYRRIKDNGHAVVVVAEGAGQRLIPRTTTTSASGACAGADESGNETFLDVGAWLKAEM
RAWWEEEHAGEVFTVKYIDPTYMIRAVPANAGDNLYCTLLAHAAIHGAMAGYTGFVSGTI
NGNYAYIPMDEVAEAKNPVDTKDHKWAWVRSITNQPDFIRAGPTS
NT seq 1398 nt   +upstreamnt  +downstreamnt
atggacgacgacggcgagacgccgatgccgtcgctcgagctccacaagctccccaccctc
gccggcgccgccatcccgaacccgatcgcgcgccacccgctgtaccacccgtcgccgagc
ttcttcatctcccccaccgacgtcgtcctccgcgacatcctcttcgacgcctcgccggcg
tcggccgccggtgagcggcggcggcggcatgtcgcggcgtaccaccgcgcgggccctcgc
cgcgaggtcgcgttcgacccagcgacggtgcgcgcggccatcttcacctgcggcgggctc
tgccccgggacgaacaccgtcgtgcgagagctcgtcgtcgggctgtccgagctctacggc
gtgcgcggcggcgtgttcggcgtgcggaacgggtaccgcggcttctactccgacgaggtc
gtcccgctcgacccggcggcggtggagcactggcacaaggccggcggggcggcgctcggc
acgtcgcgcggcgggttcgacctcgccaggatcgtggacgccatcgagcggcacgggttc
aaccaggtgtacgccgtcggcggcgacggcacgatgcgcggcgcggcgaggatccaccgc
gaggtccggcggcgggggcggctcgccgtggcggtggcggggatcccgaagacggtggac
aacgacgtcggcgtcgtcgaccggtcgttcgggttccacacggcggtggaggcggcgcag
caggcgatcgccgccgggcacgtggaggccgagagcgcggcgaacggcgtcggcctcgtc
aagctcatgggccggagcgccggccacatcgcgctccacgccacgctcagcagccgcgac
gtcgactgctgcctcatcccggaggaggacttctacctccgcggcgccggcggcctcttc
gacttcctctaccgccgcatcaaggacaacggccacgccgtcgtcgtcgtcgccgagggc
gccggccaacgtctcatcccaagaaccaccaccacctcggcctccggcgcctgcgccggc
gccgacgagtcggggaacgagacgttcctggacgtgggggcgtggctgaaggcggagatg
agggcgtggtgggaggaggagcacgccggcgaggtgttcacggtgaagtacatcgacccg
acgtacatgatccgcgccgtgccggcgaacgccggcgacaacctgtactgcacgctgctg
gcgcacgcggcgatccacggcgccatggccgggtacaccggcttcgtctccggcacgatc
aacggcaactacgcctacatccccatggacgaggtggccgaggcgaagaaccccgtggac
accaaggaccacaagtgggcttgggtcaggtccatcaccaatcagcccgactttatccgg
gccggtccgacgagctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348582
Entry
4348582           CDS       T01015                                 
Name
(RefSeq) ATP-dependent 6-phosphofructokinase 5, chloroplastic
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00030  Pentose phosphate pathway
osa00051  Fructose and mannose metabolism
osa00052  Galactose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
osa03018  RNA degradation
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4348582
   00030 Pentose phosphate pathway
    4348582
   00051 Fructose and mannose metabolism
    4348582
   00052 Galactose metabolism
    4348582
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4348582
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:osa01009]
    4348582
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4348582
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     4348582
Protein phosphatases and associated proteins [BR:osa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     4348582
Messenger RNA biogenesis [BR:osa03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     4348582
SSDB
Motif
Pfam: PFK
Other DBs
NCBI-GeneID: 4348582
NCBI-ProteinID: XP_015614885
UniProt: A0A8J8YCT6 Q338G3
LinkDB
Position
10:complement(13848954..13853496)
AA seq 524 aa
MALKSPVDFAGSITSGQKDPCCFGVPGCNPRCVRYNKKSRTCRLVTRAISVDRPQLDFSN
SDWKKQFQEDFDRRFSLPHLKDVIDVEPRPTTFSLKSRTPLENVNGSMQGSWNGYVNDDD
RALLKVIKFASPTSAGADCIDPDCSWVEQWVHRAGPRKQIYFEPQYVKAGIVTCGGLCPG
LNDVIRQIVLTLEKYGVKNIVGIQHGFRGFFEDHLAEVPLNRQVVQNINLAGGSFLGVSR
GGANISDIVDSIQARRLDMLFVLGGNGTHAGANLIHEECRKRKLKVSIVGVPKTIDNDIL
LMDKTFGFDTAVEAAQRAINSAYIEAHSAFHGIGLVKLMGRSSGFITMHASLSSGQVDIC
LIPEVPFTLDGPNGVLQHLEHLIETKGFALICVAEGAGQEHLQQSNATDASGNMILGDIG
VHLHQKIKAHFKEIGVHSDVKYIDPTYMVRAVRANASDAILCTVLGQNAVHGAFAGFSGI
TTGICNTHNVYLPISEVIKSTRFVDPNSRMWHRCLTSTGQPDFH
NT seq 1575 nt   +upstreamnt  +downstreamnt
atggctctaaaatcaccagtggattttgctggctcaatcacttcaggccagaaggacccg
tgttgttttggtgtgcccggctgcaatccgcgatgtgttagatacaataagaaatcaaga
acatgccgattggttactagagccatatccgtcgatcgcccgcagctagacttctcaaac
tcagactggaagaagcagttccaggaggatttcgataggcggttcagtttgcctcacttg
aaagatgtaatcgacgttgaaccgaggccaacaacgttttccctcaagagcaggacccct
ctggagaatgttaatggttctatgcaaggatcatggaatggctatgtgaatgacgatgac
agagcacttttgaaggttattaagtttgcttcaccaacatctgctggagctgattgcatt
gaccctgattgcagctgggtcgaacaatgggtgcaccgtgctggcccacgtaaacaaata
tattttgaacctcagtatgtaaaggctggaattgtcacctgtggtggactttgccctggt
ctcaatgatgtcattcggcagattgtgcttacactggaaaaatatggagtgaaaaacatt
gttggaatacagcatggtttccgtggattttttgaggatcatttagcagaagtgccactt
aataggcaagttgtccagaatatcaatcttgctggtggaagtttcttaggagtttctcgt
ggtggagcaaatatctcagacattgtcgacagcatacaggcccggaggcttgacatgctc
tttgttctaggtggaaatggaactcatgctggagctaaccttatacatgaggagtgccgc
aagagaaaactgaaagtatcaattgtgggcgttccaaaaaccattgataatgacatacta
ctgatggacaagacatttggatttgatacagcagttgaagcagcacagagagctataaac
tctgcatatattgaggcacattctgcatttcatggcattggattggtcaagctgatggga
agaagcagtggctttatcacaatgcatgcttccctgtctagtggccaagtagatatctgc
ctgatacctgaggtaccgttcactcttgatgggccaaatggagttcttcaacaccttgag
cacttgatagaaaccaagggatttgctctgatttgtgtagccgaaggagcgggacaggaa
catctgcaacagtcaaacgcaactgatgcatcagggaacatgatccttggtgatatcggc
gtgcaccttcatcagaagatcaaggcccatttcaaggaaataggagtacattctgatgtg
aagtacattgatcctacatacatggtccgtgctgtgcgtgccaatgcatccgatgccatc
ctatgcactgtgcttggtcagaatgctgttcatggtgcatttgcagggttcagtggcatc
acaaccggcatatgcaacacgcacaacgtctacttgccaatctcagaagtcatcaagtcc
acaaggttcgtcgatccaaacagcaggatgtggcaccggtgtttgacatcaacagggcaa
ccagacttccactga

DBGET integrated database retrieval system