KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327232
Entry
4327232           CDS       T01015                                 
Name
(RefSeq) delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial
  KO
K12663  Delta3,5-Delta2,4-dienoyl-CoA isomerase [EC:5.3.3.21]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4327232
Enzymes [BR:osa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.21  Delta3,5-Delta2,4-dienoyl-CoA isomerase
     4327232
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-GeneID: 4327232
NCBI-ProteinID: XP_015629135
UniProt: Q8RUL6 Q7F0X0
LinkDB
Position
1:40563522..40566340
AA seq 291 aa
MAGSGGGDRGSPEAELRRGFKTLAVTRPDPSAAVYEVRLNRPTRLNALSPDAFAEIPRAM
ALLDRAPAARAVVLSAAGPHFCAGIELGSPGSPATAPSGDPAPAAAEGLRRAILEMQAAL
TAIERCRKPVVAAVHGACVGGGVEVVAACDIRCCSKDATFVLREVDMAIVADLGALQRLP
RIVGYGNAADLALTGRKITAMEAKEMGLVTRVFNSKQELDAGVAKIAKEISEKSAWAVMG
TKAVLLRSRDITVEQGLEHVATWNAAMLRSNDLEEAIQAFLEKRKPVFSKL
NT seq 876 nt   +upstreamnt  +downstreamnt
atggccggcagcggcggcggcgaccgcggctcgcccgaggcggagctccggcgcgggttc
aagacgctcgccgtgacgcggcccgacccgtccgcggcggtctacgaggtccgcctcaac
cgccccacccggctcaacgccctcagcccggacgccttcgcggagatcccgcgcgccatg
gcgctcctcgaccgcgcccccgccgcgcgcgccgtcgtgctctccgccgccggcccgcac
ttctgcgccggcatcgagctcggctcccccgggagccccgccacggccccctccggcgac
cccgcgcccgcggccgccgaggggctccgccgcgccatcctggagatgcaggcggcgctc
acggccatcgagcggtgccggaagccggtggtcgcggcggtgcacggcgcctgcgtcggc
ggcggcgtcgaggtcgtggccgcctgcgacatacggtgctgctccaaggacgccacgttc
gtgctcagggaggtggacatggccatcgtcgccgacctcggcgcgctgcagcggcttccg
cggatcgtcgggtacgggaacgccgccgacctcgcgctcaccggccgcaagatcaccgcc
atggaggccaaggagatggggctcgtgaccagggtgttcaattccaagcaagaattggat
gctggcgttgcaaagattgcaaaagaaatatctgagaagtcagcatgggcagtgatggga
acaaaggctgttttgctgagaagcagggatataacagtagagcagggcctggagcatgtt
gcaacatggaacgccgcaatgctgagatctaatgacctggaggaggctatccaagccttc
ctagagaagcggaagccagtcttctccaaactgtaa

DBGET integrated database retrieval system