KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327239
Entry
4327239           CDS       T01015                                 
Name
(RefSeq) transaldolase
  KO
K00616  transaldolase [EC:2.2.1.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00030  Pentose phosphate pathway
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
osa_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    4327239
Enzymes [BR:osa01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.2  transaldolase
     4327239
SSDB
Motif
Pfam: TAL_FSA
Other DBs
NCBI-GeneID: 4327239
NCBI-ProteinID: XP_015617463
UniProt: A0A8J8XQP5 Q5JK10
LinkDB
Position
1:complement(40610528..40613456)
AA seq 432 aa
MTGAVSKLAAPRPAAAAPLPPASVRSAFLASAPSPRRFSVSIAAGRARSPIIAMASAKEG
NGAPTKRTTLHDLYDLQGQSPWYDNLCRPVTDLLPLIGSGVRGVTSNPSIFQKAISTSNA
YDDQFKQLILAGKDAESAYWELVIKDIQDACKLFEPIYDQTDGADGYVSVEVSPRLANDT
QGTVEAAKWLHKVVDRPNVYIKIPATAECVPSIKEVIANGISVNVTLIFSIARYEAVIDA
YIDGLEASGLSDLSRVTSVASFFVSRVDTLIDKMLEKIGTPEALALRGKAAVAQAKLANQ
LYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALL
AFIDHGTVSRTIDANVSDAEGVYSALEKLGIDWDEVGKQLELEGVDSFKKAFDSLLGSLE
EKGNSLKKTVSL
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgaccggcgccgtctccaagctcgccgccccgaggccggcggccgccgcgccgctcccg
ccggcgtccgtccgctccgcgttcctcgcctccgccccctccccgcgccgcttctccgtc
tccatcgccgccggccgcgccaggagccccatcattgcgatggcttctgccaaggaagga
aatggtgccccaacgaagaggacaacccttcatgatctctatgatctccagggtcagtcc
ccgtggtacgacaacctctgccgtcctgtcaccgatttgctgccccttattggcagcggc
gtccgtggagtcaccagcaacccatcaattttccagaaagccatctcgacttccaatgca
tacgatgaccagttcaagcagcttatattagctggaaaggacgcagagagcgcttattgg
gaacttgtcatcaaggatatccaagatgcgtgcaaactttttgagcctatctacgaccag
accgatggggcagatgggtatgtttctgtggaggtctcccctaggctggcaaatgatacc
cagggaactgttgaagctgcaaaatggttgcacaaagtggtcgacaggcccaatgtctac
ataaagatccctgctaccgcagaatgtgttccttctatcaaggaagttattgctaatggc
attagtgtcaacgtcacacttatcttctcgattgcaagatacgaggctgtgattgatgct
tacattgatggacttgaggcctctggtttgagtgacctatcccgagtgaccagtgtagcg
tccttctttgtcagccgagttgacacacttattgacaaaatgctcgagaagatcggaaca
cctgaggcacttgccctcagaggaaaggctgctgtagcacaggcaaagctagccaaccag
ctttaccagaagaaattctctggcccgaggtgggaggctttggtcaagaaaggtgccaag
aagcagaggttgttgtgggcatctaccagtgtgaagaaccctgcatacccagacactctt
tacgtggatcctctcatcggacctgacaccgtttctaccatgcccgaccaagctctgctg
gcattcatcgaccacggcacagtttcgaggacaatcgacgcaaacgtttcggatgctgaa
ggtgtatacagtgccctggagaagctgggtatagattgggatgaggttggcaagcagcta
gagctggaaggtgtggactccttcaagaaggccttcgacagcctgcttgggagcttggag
gagaagggcaattccctcaagaagaccgtgagcctgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344683
Entry
4344683           CDS       T01015                                 
Name
(RefSeq) transaldolase
  KO
K00616  transaldolase [EC:2.2.1.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00030  Pentose phosphate pathway
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
osa_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    4344683
Enzymes [BR:osa01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.2  transaldolase
     4344683
SSDB
Motif
Pfam: TAL_FSA
Other DBs
NCBI-GeneID: 4344683
NCBI-ProteinID: XP_015650796
UniProt: Q0J7Y7
LinkDB
Position
8:complement(3128335..3132243)
AA seq 399 aa
MALSISTPPTSSSLLPASLQVGRWSSSAAMSARPVAFSLRRPVLAARVAAGGNAPSSSVD
EVVTELDAVASFSEIVPDTVVFDDFEKFAPTAATVSSSLLLGIAGLPDTKFKSAIDTALA
DGECNTMEKPEDRMSCFLTKALANVGAEMAHLVPGRVSTEIDARLAYDTQGIIQRVHELL
KLYSDHDVLSERLLFKIPATWQGIEASRLLESEGIQTHLTFVYSFAQAAAAAQAGASVVQ
IFVGRVRDWARTHSGDPEIDEALKKGEDAGLALAKKVYAYIHKNGYKTKLMAAAIRNKQD
VFSLLGIDYIIAPLKILQSLEESVTDTDVKYGYVPRLTPALGKTYNFTEEELVKWDQLSL
AAAMGPAAEELLASGLEGYVNQARRVEELFGKIWPPPNV
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggcgctctccatctccacgccgccgacctcctcctccctcctgccggcctccctccag
gtcggcaggtggagctcgtcggcggcgatgtcggccaggcctgtggcctttagcctccgg
aggccggttcttgcggcccgtgtagccgccggcggcaacgcaccgtcttcctccgtggac
gaggtggtcactgagctcgatgccgtggccagcttcagcgagatcgtgccggataccgtc
gtgttcgatgacttcgagaagtttgcgccgaccgccgccacggtgagctcgtcgctgctg
ctcggtatcgctggcctcccggatacaaagttcaagagtgctatagatacagcgttggca
gacggtgaatgtaacacaatggagaagcccgaggaccggatgtcctgtttcctaaccaag
gccctggcaaatgttggagctgaaatggctcatctagtccctggtcgggtgtcgactgaa
atagatgctcggttggcttatgatacccaaggaattatccagagggtgcatgagcttttg
aagctatacagtgatcatgatgtcttatctgaacgcctgctgttcaaaattccggctaca
tggcaaggtatagaggcctcgaggttgcttgaatctgaagggattcaaacacatttaaca
tttgtgtacagttttgcccaagcagcagctgcagcacaagccggtgcatctgttgtacag
atctttgtgggacgtgttcgggattgggcaaggactcactctggcgacccagagattgat
gaagctttgaagaaaggagaagatgctgggcttgctttggcgaagaaagtgtatgcctac
attcacaaaaatgggtataaaacaaagttgatggctgctgccatacgcaacaagcaagat
gtgtttagcctcctggggattgactacatcattgcacctctgaagatattgcagtctttg
gaagaatctgtcactgatactgacgtgaagtatggttatgtcccaaggctgactcctgct
cttggcaaaacgtacaacttcactgaagaggagcttgtgaagtgggaccaattgagtcta
gcagctgcaatggggccagctgcggaagaactacttgcttctgggttggaaggatatgtg
aaccaagcacgccgagtggaggaactcttcgggaagatctggcctcctccgaatgtttga

DBGET integrated database retrieval system