KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327257
Entry
4327257           CDS       T01015                                 
Name
(RefSeq) 50S ribosomal protein L27, chloroplastic
  KO
K02899  large subunit ribosomal protein L27
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4327257
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4327257
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    4327257
  Bacteria
    4327257
SSDB
Motif
Pfam: Ribosomal_L27
Other DBs
NCBI-GeneID: 4327257
NCBI-ProteinID: XP_015625267
UniProt: O65037
LinkDB
Position
1:40453834..40455610
AA seq 195 aa
MASMAFTLVGAFKGMSLSSPCHSSSSASFLRADRVSLSVGGGVGMGVPMTMPVRRLTIQM
AHKKGAGSTKNGRDSPGQRLGVKIYGDQVAKPGAIIIRQRGTRVYPGNNVGMGKDHTLFS
LIDGLVKFEKYGPDKKKVSVYPYEKQPENPNSYRARKREYFRMQRERKKARAEGIVEVQL
VLAAADESPEVNADC
NT seq 588 nt   +upstreamnt  +downstreamnt
atggcgtccatggcgttcacactggtgggagcattcaaggggatgtccctctcctccccg
tgccattcctcctcctccgcctccttcctccgcgctgaccgtgtctcgctctccgtcggc
ggcggggtcgggatgggggtgccgatgacgatgccggtgcggcggctgacgatccagatg
gcgcacaagaagggggccgggagcaccaagaacgggagggactcccccgggcagcgcctc
ggtgtcaagatttacggcgaccaggtcgccaagcccggcgccatcatcatccgccagcgc
ggcaccagggtctatcctggaaataatgttggaatgggcaaggatcacaccctcttttct
ttgatcgatggcctcgtaaagttcgagaaatatggaccagacaagaaaaaggtaagtgtt
tacccatacgagaaacaacctgagaacccaaacagttacagagcaagaaagagagagtac
ttccgcatgcagcgtgaacgcaaaaaggcaagagcagagggaattgttgaggtgcaattg
gtgttggcagctgcagatgaaagtcctgaggtcaatgcagactgctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335476
Entry
4335476           CDS       T01015                                 
Name
(RefSeq) 50S ribosomal protein L27
  KO
K02899  large subunit ribosomal protein L27
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4335476
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4335476
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    4335476
  Bacteria
    4335476
SSDB
Motif
Pfam: Ribosomal_L27
Other DBs
NCBI-GeneID: 4335476
NCBI-ProteinID: XP_015635048
LinkDB
Position
4:14804657..14805743
AA seq 147 aa
MAFSSVFRRGNVKELISNVSVYTSTVGNESSGGLSLIFKRWATKKTAGSTKNGRDSNPKY
LGVKKFGGEKVEPGNIIVRQRGTRFHPGNYVGMGKDHTLFCLKEGHVRFERNKLTGRKWV
HVDPVAGHVLHPVYTSDSTPAAEMEPL
NT seq 444 nt   +upstreamnt  +downstreamnt
atggctttttcatcagttttcaggagaggaaatgtcaaagaattgatctcaaatgtttcg
gtctacactagcacagtaggtaatgagtcatctggaggattgagcttgatttttaagcgt
tgggccaccaaaaagacagctggatcaacaaaaaatggccgtgactctaaccctaagtat
ttgggtgttaaaaagtttggcggagagaaagtggagccaggaaacatcatcgtccgccaa
agaggaacccgcttccatcctgggaactacgttggcatggggaaggaccatactctcttc
tgtctgaaagaaggacatgtgcgattcgagcgcaacaagctgactggcaggaaatgggtt
catgttgatcctgttgctgggcatgtgctccaccctgtctacaccagtgattcgacccct
gcagctgaaatggagccattgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345523
Entry
4345523           CDS       T01015                                 
Name
(RefSeq) 50S ribosomal protein L27
  KO
K02899  large subunit ribosomal protein L27
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4345523
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4345523
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    4345523
  Bacteria
    4345523
SSDB
Motif
Pfam: Ribosomal_L27
Other DBs
NCBI-GeneID: 4345523
NCBI-ProteinID: XP_015648127
UniProt: A3ASB5 Q6ZKP0
LinkDB
Position
8:19307327..19311003
AA seq 145 aa
MAFSSVFRRGNVKELISNVSVYTSAAESSGGLSLIFKRWATKKTAGSTKNGRDSNPKYLG
VKKFGGEKVEPGNIIIRQRGTRFHPGNYVGMGKDHTLFCLKEGHVRFERNKLTGRKWVHV
DPVAGHVLHPVYASDSTPAAEMEPL
NT seq 438 nt   +upstreamnt  +downstreamnt
atggctttttcatcagttttcaggagaggaaatgtcaaagaattgatctcaaatgtttcg
gtctacactagcgcagcagagtcatctggaggattgagcttgatttttaagcgttgggcc
accaaaaagacagctggatcaacaaaaaatggccgtgactctaaccctaagtatttgggt
gttaaaaagtttggcggagagaaagtggagccaggaaacatcatcatccgccaaagagga
acccgcttccatcctgggaactacgttggcatggggaaggaccatactctcttctgtctg
aaagaaggacatgtgcgattcgagcgcaacaagctgactggcaggaaatgggttcatgtt
gatcctgttgctgggcatgtgctccaccctgtctacgccagtgattcgacccctgcagct
gaaatggagccattgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9271228
Entry
9271228           CDS       T01015                                 
Name
(RefSeq) 50S ribosomal protein L27
  KO
K02899  large subunit ribosomal protein L27
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    9271228
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    9271228
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    9271228
  Bacteria
    9271228
SSDB
Motif
Pfam: Ribosomal_L27
Other DBs
NCBI-GeneID: 9271228
NCBI-ProteinID: XP_015648583
UniProt: A3ASB5 Q6ZKP0
LinkDB
Position
8:19304532..19305848
AA seq 145 aa
MAFSSVFRRGNVKELISNVSVYTSAAESSGGLSLIFKRWATKKTAGSTKNGRDSNPKYLG
VKKFGGEKVEPGNIIIRQRGTRFHPGNYVGMGKDHTLFCLKEGHVRFERNKLTGRKWVHV
DPVAGHVLHPVYASDSTPAAEMEPL
NT seq 438 nt   +upstreamnt  +downstreamnt
atggctttttcatcagttttcaggagaggaaatgtcaaagaattgatctcaaatgtttcg
gtctacactagcgcagcagagtcatctggaggattgagcttgatttttaagcgttgggcc
accaaaaagacagctggatcaacaaaaaatggccgtgactctaaccctaagtatttgggt
gttaaaaagtttggcggagagaaagtggagccaggaaacatcatcatccgccaaagagga
acccgcttccatcctgggaactacgttggcatggggaaggaccatactctcttctgtctg
aaagaaggacatgtgcgattcgagcgcaacaagctgactggcaggaaatgggttcatgtt
gatcctgttgctgggcatgtgctccaccctgtctacgccagtgattcgacccctgcagct
gaaatggagccattgtaa

DBGET integrated database retrieval system