KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327279
Entry
4327279           CDS       T01015                                 
Name
(RefSeq) protein translocase subunit SECA1, chloroplastic
  KO
K03070  preprotein translocase subunit SecA [EC:7.4.2.8]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03060  Protein export
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    4327279
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:osa02044]
    4327279
Enzymes [BR:osa01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     4327279
Secretion system [BR:osa02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   4327279
SSDB
Motif
Pfam: SecA_DEAD SecA_SW SecA_PP_bind DEAD
Other DBs
NCBI-GeneID: 4327279
NCBI-ProteinID: XP_015621810
LinkDB
Position
1:complement(12235318..12248234)
AA seq 1015 aa
MAMAPPAAATCATALRFAHPSSSSSSSSSSSSSSLPSPRPLGGACGGRPQHGRRSLRAPR
RRGGGDRVAARAGLGGLLGGMFGGAGGDDGDAARKRYADTVARVNSMEPEVSALSDADLR
ARTAKLQERARAGESLDSLLPEAFAVVREASKRVLGLRPFDVQLIGGMVLHKGEIAEMKT
GEGKTLVAILPAYLNALSGKGVHVVTVNDYLARRDCEWVGQVPRFLGLQVGLIQQNMTPE
QRRENYLCDITYVTNSELGFDYLRDNLAMTVDELVLRNFNYCVIDEVDSILIDEARTPLI
ISGLAEKPSDRYYKAAKIAEVFERDIHYTVDEKQRNVLLTEEGYADAEEILDINDLYDPR
EQWASYVLNAIKAKELFLRDVNYIVRSKEVLIVDEFTGRVMPGRRWSDGLHQAIEAKEGV
PIQNETITLASISYQNFFLQFPKLCGMTGTAATESQEFESIYKLKVTVVPTNKPMIRKDE
SDVVFRATNGKWRAAVVEISRMNKVGRPVLVGTTSVEQSETLSEQLHEAGIPHEVLNAKP
ENVEREAEIVAQSGRLGAVTIATNMAGRGTDIILGGNAEFMARLKLREMLMPRVVDPLDG
VIISKKQASPKKTWKTNESLFPCELSKDALSYVKESVEVAVKAWGEKSLTELEAEERLSY
SCEKGPTRDEVIANLRSAFMKIMDEYKVYTEEEKKQVISAGGLHVVGTERHESRRIDNQL
RGRSGRQGDPGSSRFFLSLEDNIFRIFGGDRIQGLMQAFRVEDLPIESKMLTRALDEAQR
KVENYFFDIRKQLFEYDEVLNSQRDRVYAERRRALASDSLESLIVEYAELTIDDILEANI
GPDTPREDWDLSKLIAKLQQYCYLLDDLTPELLEGKSSSYEDLQEYLRTRGREAYYQKAE
IVEKQAPGLMKEAERFLILSNIDRLWKEHLQALKFVQQAVGLRGYAQRDPLIEYKLEGYN
LFLDMMAQIRRNVIYSVYQFKPVMKNQEEEKSEKKGTKKKVDKGANKLGAAQAAS
NT seq 3048 nt   +upstreamnt  +downstreamnt
atggccatggcgcctcccgccgccgcgacctgcgccaccgccctgcgcttcgcccaccca
tcttcttcctcttcctcctcctcttcttcttcttcgtcttctctcccttccccgcgtcct
ctcggtggcgcctgcggcggccgcccccagcacgggcgacggagcctccgggccccgcgg
cggcggggtggtggggaccgcgtcgccgcgcgcgccgggctggggggcctgctgggcggc
atgttcggcggggccggcggcgacgacggggacgccgcgaggaagaggtacgccgacacc
gtggcgcgtgtcaactccatggagcccgaggtctccgcgctctccgacgccgacctccgc
gcccgcaccgccaagctgcaggagcgcgcgcgcgccggggagtccctcgattccctcctg
cccgaagcatttgcagttgtgagggaagcttccaagagagttttgggccttcgtcccttt
gatgtacagttgattggtggaatggttctgcacaagggggagattgcagaaatgaaaaca
ggagaagggaagacccttgtggccattttaccagcttacttaaatgctttgagtggaaaa
ggggtgcatgttgtaactgtaaatgattatcttgcaagacgtgattgcgaatgggttggt
caggttccccgatttctaggactgcaggttggcctaattcaacaaaacatgacacctgag
caaaggagggagaattacttgtgtgatattacttatgttacaaacagtgagcttggtttc
gattatctaagagataaccttgcaatgactgttgatgagcttgtcctgaggaactttaac
tattgtgtgatagatgaagttgattccattctcattgatgaagcaagaacacctcttata
atatcaggccttgctgaaaagccaagtgatcggtattacaaagcagcaaaaatagctgaa
gtttttgaaagagatattcattacactgttgatgaaaagcagagaaatgttttacttaca
gaagaaggctatgcggacgctgaagaaatactggacataaatgatctatacgatcctcgt
gaacaatgggcttcatatgttctgaatgcaatcaaagctaaggaactcttccttagagat
gtgaattacattgtccgtagcaaggaagtgcttattgtggatgagttcacaggtcgagta
atgccaggcagaagatggagtgatggtcttcaccaagcaattgaagctaaagaaggtgta
cctatacaaaatgaaacaattacccttgcgtcaataagttatcagaacttctttctacag
tttccgaaactatgtggcatgactggaactgctgctacggaaagccaagagttcgaaagc
atatacaaactaaaagttaccgttgttccaacaaacaagccaatgatacgaaaggatgaa
tcggatgttgtttttagagcaacaaatggaaaatggcgtgctgctgtcgtggagatatca
agaatgaacaaagttggtcgccctgtgcttgttggtacaactagtgttgaacaaagtgaa
accttatcagaacaattgcatgaagcagggattcctcatgaggtcctcaatgctaaacca
gagaatgtagagagggaggcagaaattgtagctcagagtggacgccttggtgcagtgaca
attgccaccaatatggcgggacgtggtactgatattattcttggaggaaatgcagaattc
atggcaaggttgaagctgcgtgagatgcttatgccaagagttgttgatccattggatggt
gtcattatatctaaaaagcaggcctcacctaagaagacatggaagacaaatgaaagtttg
ttcccatgtgaactttcaaaagacgcactatcatatgttaaagagtctgttgaagtggct
gtcaaagcctggggagaaaaatcattgaccgagctagaagctgaagagcggctctcctac
tcatgtgagaagggaccaactcgtgatgaagtaattgcaaatctgagaagtgcattcatg
aagataatggatgaatataaggtttacacagaggaggaaaagaagcaggtcatttcagca
ggtggacttcatgtagtaggaacagaacgtcatgaatctcgcagaattgataatcagctc
cgtggtcgaagtggcaggcaaggggatcctgggagctctcggttctttcttagtcttgag
gataatatattccgaatttttggaggtgacaggatacagggtttgatgcaagccttcaga
gtcgaagatcttcctattgagtcgaagatgctgacaagggctctagatgaagctcaacgg
aaagttgagaactatttcttcgatatcaggaagcaattatttgagtatgatgaggtattg
aatagccaaagagatcgagtatatgcagaaagaagacgcgctcttgcgtctgatagtctt
gaatcacttattgtggaatatgctgaattaacaattgatgacattttagaggcaaacatt
ggccctgataccccgagagaagattgggatcttagcaaactgatagctaaacttcaacag
tattgctatctattagatgatttgacaccagaattgttggagggcaaatcgtcaagctat
gaggatttgcaagagtaccttcgtacccgaggacgtgaagcatactaccaaaaagctgag
attgtggagaaacaagctccaggcttgatgaaagaagctgagaggttccttattctaagc
aacattgataggctctggaaggaacacttgcaggcattgaagtttgtgcaacaggctgtt
ggtttgaggggttacgcccaacgagatcctcttattgaatataaactggagggatataat
cttttcttggatatgatggctcaaattcgacggaatgtaatttactctgtttatcagttc
aagccagtgatgaagaaccaagaagaggagaaatctgaaaagaaggggacaaagaagaaa
gtcgacaagggtgctaacaaacttggtgctgcccaagctgcatcttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349987
Entry
4349987           CDS       T01015                                 
Name
(RefSeq) protein translocase subunit SECA2, chloroplastic isoform X1
  KO
K03070  preprotein translocase subunit SecA [EC:7.4.2.8]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03060  Protein export
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    4349987
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:osa02044]
    4349987
Enzymes [BR:osa01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     4349987
Secretion system [BR:osa02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   4349987
SSDB
Motif
Pfam: SecA_DEAD SecA_SW SecA_PP_bind DEAD
Other DBs
NCBI-GeneID: 4349987
NCBI-ProteinID: XP_015615106
LinkDB
Position
11:4761961..4771726
AA seq 1062 aa
MAFAGATAAAASLSSSAPSILLVSAVTPPPRLLPTSSILSPVYSARPKRPPTLSCNAAAA
TVAAAAAGKPGSWRDLCSLNAWVVRDYRRLVDAVGALEPRLRGLTDERLRAKTDEFRARL
ARGETLADVQAEAFAVVREAARRTLGMRHFDVQIIGGAVLHDGCIAEMKTGEGKTLVSTL
AAYLNALTSEGVHVVTVNDYLAQRDAEWMGRVHRFLGLSVGLIQAGMKADERRANYRCDI
TYTNNSELGFDYLRDNLSRNKEQLVMRWPTPFHFAIVDEVDSVLIDEGRNPLLISGEDNR
DAARYPVAAKAADLLMEGFHYTVELKSNNIDLTEDGVTCAEMILETNDLWDENDPWARFV
MNALKAKEFYRRDVQYIVRDGKALIINELTGRVEPKRRWSDGIHQAVEAKEGLKIQADSV
IVAQITYQSLFKLYPKLSGMTGTAKTEEKEFLKMFKTPVIEVPTNLPNIRVDLPIQAFAT
ARGKWQYVRAEVESMFHLGRPVLVGTTSVESSEYLSDLLKARNIPHNVLNARPKYAAREA
EIVAQAGRKHAITISTNMAGRGTDIILGGNPKMLAKEIIEDNVLPFLTHEPPDVETVGES
TSHKGLSKIKLGPSSLGLLAKAAIIAKYVQRSERNEWPFQKAKSTIAESVEMSHTIGMEK
LQDRLAEESEMYPLCDTIGLAYLTVLRDCEIHCSTEGAEVKALGGLHVIGTSLHESRRID
NQLRGRAGRQGDPGSTRFMVSLQDEMFRKFNLDTEWAVRLISRITNDEDIAIESNAVVKQ
LLGLQINAEKYYFGIRKSLVEFDEVLEVQRKHVYNLRQVILSGDSESCSEQIFQYMQAVA
DDIILGNADPQKPPNTWKLANLLDEFGSLGGTLLDEPFKEIQEEDLLSSLEQIHEYGPVN
VDNFTLPNMPVSPNSFRGIWKRTSSMMRWLAICVDDASKKGRYTYIVNMLRKYFGDFLIA
TYLDAVQESRYDDAYIRGIEREILLKTLDTLWKDHLVNMNKLSSAVNVRSFGHRNPLEEY
KIDGCRFFISMLGATRRLTVESLLHYWSSPMESEEIFNTGDK
NT seq 3189 nt   +upstreamnt  +downstreamnt
atggcgttcgccggcgccaccgccgccgccgcctctctctcctcctccgccccttccatc
ctcctcgtctccgccgtcactcccccgccccgcctcctccccacaagctccatactctcg
ccggtatacagcgccaggcccaagcggcctcctactctctcctgcaacgccgccgccgcc
accgtcgcggccgccgctgcggggaagcccgggtcgtggagggacctatgtagcctcaac
gcctgggtggtgcgggactaccgtcgcctcgtggacgccgtgggggcgctcgagccgcgg
ctccgggggctcaccgacgagcggctcagggcgaagacggacgagttccgcgcccgcctc
gcccgtggggagacgctcgccgacgtccaagcagaggcgtttgccgtggtgagggaggcg
gcgaggaggacgctggggatgcgccacttcgatgtccagataataggtggtgctgtactg
catgatgggtgcatcgcggagatgaagactggcgaggggaagacgcttgtgtctaccttg
gcggcttatctcaatgcgctcacaagcgaaggcgttcatgttgtgactgtaaatgattat
ttggcacagcgagatgctgaatggatgggtcgtgtgcatcgttttcttggtctttccgtg
ggtctaattcaggctggtatgaaggctgacgagagaagagccaactataggtgtgacatt
acatacactaacaactcggagcttggatttgactatcttcgtgataacttatcacggaac
aaagaacagctagttatgagatggccgacaccattccattttgcaattgtggatgaagtg
gactcagtgcttattgatgagggaagaaacccattgttaataagtggagaggataataga
gatgcggcacggtatccagtagctgctaaagctgcagaccttcttatggagggttttcat
tacactgttgaactaaagagcaataatatagatctcacagaggatggagttacttgtgct
gagatgattcttgagacaaatgatctatgggatgagaacgatccatgggcaagatttgtg
atgaatgcattgaaggccaaagagttttaccgcagggatgtccaatatattgtgagggat
ggaaaagctctcataattaatgagctaactggccgagttgaaccaaaaagaaggtggtct
gatggtattcatcaagcagtagaagcaaaagaaggcctcaaaattcaggcagattcagta
atcgtggctcagattacatatcaatcgttatttaagctttatcctaaactttctgggatg
acagggacagctaaaacagaggaaaaggaatttctgaagatgtttaagacgccagttatt
gaagtgcccacaaatctgccaaatatacgggtggacttgcctatccaagcttttgcaact
gcaagaggtaaatggcaatatgtgcgggcagaggtagagtccatgtttcatttgggtcgt
ccagttttagttggcactacaagtgttgagagttcagagtacttgtcagatcttcttaaa
gctcgcaatattcctcacaatgtccttaatgcaaggccaaagtatgccgcaagagaagct
gaaattgttgcacaagccggaaggaaacatgctattacaatttcaactaacatggctggc
agaggaacagatattattttaggtggtaaccctaagatgcttgcaaaagaaattatagaa
gataatgtgcttccatttcttacccatgaacccccagatgttgaaaccgtaggcgaatcc
acatcccacaagggtctctccaaaattaaacttgggccatcatcgctaggcctgcttgct
aaagctgcaatcatagcgaaatatgttcagagaagcgaaagaaatgaatggccttttcag
aaggcaaaatctactattgctgagtctgtagaaatgagtcatactattgggatggagaaa
ctgcaagatcgcttggctgaagagtctgagatgtatcctctttgtgatacaataggactt
gcttatcttactgtattgagggattgtgaaattcattgttctactgaaggtgctgaggtg
aaggcattagggggtctccatgtaataggaacttctttgcatgagtcacgccgaatagat
aaccaattacgtggcagagctggcagacaaggtgatcctgggtcaacaaggtttatggtt
agcttacaagatgaaatgttccggaaattcaatttggacactgaatgggctgtgagactt
atatcaaggataacaaatgatgaagacatagctattgagagcaatgctgttgtaaaacag
cttctaggtcttcaaatcaatgcagaaaagtattattttggtattaggaaaagtcttgtt
gagtttgatgaagtcttggaggtacaaagaaagcatgtttataaccttagacaggttata
ttatcaggtgactctgaaagctgcagtgagcaaatctttcagtacatgcaagctgtagct
gatgatattatcttgggaaatgctgatccccagaagcctcctaacacgtggaagttggca
aaccttttggacgagtttggcagtctaggtggaacgttacttgatgaaccattcaaggaa
attcaagaggaagacttgctatcatcacttgagcaaattcatgaatatggccctgtgaat
gttgataattttactcttccaaatatgccagtatcacctaattcattcagaggaatctgg
aagagaacatcttcaatgatgcggtggcttgccatatgtgttgatgatgcatcgaagaaa
ggaagatacacgtacattgtcaatatgcttcgcaaatattttggggattttctaatagct
acatacttggatgctgtgcaagagtcccgttatgatgatgcatacattcgaggaattgag
agggaaatactactgaagactcttgatactctgtggaaggaccatttggtgaacatgaac
aagcttagttctgcggtgaatgtgcggagctttggacatagaaaccctttagaagaatac
aagattgatggttgtcggttcttcatctcgatgttgggtgccacacggagattgacagtg
gaatcactactccattactggtcatctccaatggagtctgaggaaatcttcaatacaggt
gataaatag

DBGET integrated database retrieval system