KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327293
Entry
4327293           CDS       T01015                                 
Name
(RefSeq) caffeoylshikimate esterase isoform X1
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa01100  Metabolic pathways
Module
osa_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4327293
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    4327293
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     4327293
Peptidases and inhibitors [BR:osa01002]
 Serine peptidases
  Family S33
   4327293
SSDB
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Peptidase_S9 AXE1 BD-FAE Abhydrolase_11 Esterase FSH1 DLH
Other DBs
NCBI-GeneID: 4327293
NCBI-ProteinID: XP_015620899
LinkDB
Position
1:11897376..11907429
AA seq 349 aa
MEVEYHEEYVRNSRGVQLFTCGWLPAKTSPKALVFLCHGYAMECSGYMRECGMRLAAAGY
GVFGMDYEGHGKSMGARCYIRSFRRLVDDCHRFFKSICDMEEYRSKSRFLYGESMGGAVA
LLLHMKDPTFWDGAILVAPMCKISEKVKPHPVVISLLTQVEDVIPRWKIVPTKDVIDAAF
KDPAKREKIRKNKLIYQDKPRLKTALEMLRTSMYVEDSLSKVKLPFFVLHGDADTVTDPE
VSRALYERAASADKAIKLYAGMWHGLTAGEPDHNVDAIFSDIVAWLNGRSRTWTVEDRLM
KMMASPDRFIRGERGGAADVDGDAKRGPPRRRGGCFSGLAGRTHHHSEM
NT seq 1050 nt   +upstreamnt  +downstreamnt
atggaagtcgaataccacgaggagtacgtgcggaactcgagaggggtgcagctcttcacc
tgcggctggctgcccgccaaaacgtcgcccaaggccctcgtcttcctctgccacggctat
gccatggagtgcagcggctacatgagagagtgtgggatgcggctggcggcggcggggtac
ggggtgttcggcatggactacgaggggcacggcaagtcgatgggcgcccgctgctacatc
cgcagcttccgccgtctcgtcgacgactgccaccgcttcttcaagtccatctgcgacatg
gaggagtacaggagcaagagccggttcctgtacggcgagtccatgggcggcgcggtggcg
ctgctgctgcacatgaaggacccaacgttctgggacggcgccatcctcgtcgcgccaatg
tgcaagatatcggagaaggtgaagccgcacccggtggtgatctctctcctgacgcaggta
gaggacgtcatccccaggtggaagattgttcccaccaaggacgtcatcgacgccgccttc
aaggaccctgccaagcgcgaaaagatcaggaagaacaagctgatataccaggacaagccg
aggctcaagaccgcacttgagatgctcaggaccagcatgtacgtagaggacagcttgtcc
aaggtgaagctgccgttcttcgtgctgcacggcgacgccgacacggtgacggacccggag
gtgagccgggcgctgtacgagcgcgccgccagcgccgacaaggccatcaagctctacgcc
gggatgtggcacggcctcaccgccggcgagcccgaccacaacgtcgacgccatcttctcc
gacatcgtcgcctggctcaacgggcgcagccgcacctggacggtggaggaccgcctgatg
aagatgatggcgtcgccggacaggttcatccgcggcgagaggggcggcgccgctgacgtc
gacggtgacgccaagcgcggccctccacggcggcgcggcggctgcttctccgggctcgcc
ggccgaacgcatcaccactcggaaatgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327366
Entry
4327366           CDS       T01015                                 
Name
(RefSeq) caffeoylshikimate esterase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa01100  Metabolic pathways
Module
osa_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4327366
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    4327366
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     4327366
Peptidases and inhibitors [BR:osa01002]
 Serine peptidases
  Family S33
   4327366
SSDB
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Peptidase_S9 Peptidase_S15 Esterase Abhydrolase_11
Other DBs
NCBI-GeneID: 4327366
NCBI-ProteinID: XP_015621251
LinkDB
Position
1:35893165..35895312
AA seq 306 aa
MAMDQYSENIKYDEEFFVNSRDNKLFTCRWTPHKQEPKALIFICHGIAAECGVSMRDTAA
RLVRAGYAVYGIDHEGHGRSSGQRCYIPNFGDIVSDCANFFTSICEKPENREKKRFLYGI
SMGGGVALLLHRKEPTYWDGAVLLAPMCKIPDDMRPHPIAVSALKMVCAVAPSWRIIPTP
DIIDKVCKDPEMRKQVRSNPYIYRGKLPLKTCHELLMVSLDIEKNLHEVTLPFLVLHGGD
DIVTDPSVSKLLFEEASGRDKTFKLYPGMWHALTAELPDDVERVYSDIISWLDERSDCAG
SVPETF
NT seq 921 nt   +upstreamnt  +downstreamnt
atggccatggatcagtacagtgagaatatcaagtatgacgaggagttttttgtgaactcc
cgtgacaacaagctgttcacctgcagatggacaccgcataaacaagaaccaaaagctctg
atctttatctgtcatggaatcgcagcagagtgcggcgtatcgatgagagacaccgccgct
cgattggtgcgagccggatatgccgtttacgggattgatcatgaaggccacggtagatca
tctggtcagagatgctacataccaaacttcggtgacatcgtctcagactgcgcaaacttt
ttcacgagtatttgcgagaagccggagaacagggagaagaagaggttcctgtacggcatc
tccatgggtggaggcgtggcgcttctcctccacaggaaggagccaacctactgggatggc
gccgtcttgcttgctcctatgtgcaagattcctgatgacatgcggcctcacccgatcgcg
gtcagcgctctgaaaatggtgtgcgctgtggctcctagttggagaatcatacccacaccg
gacataattgacaaagtttgtaaagatccagagatgagaaagcaggttcgctcaaatccg
tacatatacaggggaaagctcccactgaagacctgtcatgaactcctgatggtcagccta
gacattgagaagaacctgcatgaggtgacactgccgttcttggtcctacacggcggagac
gacatcgtgaccgatccttcggtgagcaagctgctgttcgaagaagcatcaggcagggac
aaaactttcaagctttaccctgggatgtggcatgctctgacggctgagcttcctgacgat
gtcgagcgtgtctattctgacatcatctcctggctggacgaaaggtcggattgtgcaggc
agtgttcctgaaactttctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333927
Entry
4333927           CDS       T01015                                 
Name
(RefSeq) monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa01100  Metabolic pathways
Module
osa_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4333927
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    4333927
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     4333927
Peptidases and inhibitors [BR:osa01002]
 Serine peptidases
  Family S33
   4333927
SSDB
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 FSH1 Peptidase_S15 Peptidase_S9
Other DBs
NCBI-GeneID: 4333927
NCBI-ProteinID: XP_015628096
UniProt: Q6ASW1 A0A0P0W2E4
LinkDB
Position
3:complement(29150105..29153908)
AA seq 392 aa
MAGSMQAAEAAGRISALLSLLALRRLIALLQPLALLLLLPFRWRGARPGAAAAAAAAAAD
AVAASVASGGKKGKAAVVLRVPAGSPIVAARRQASARREIAARRAREAGREYELIPTHRG
ETLFTQCWWPHGSSSAIKPRALVVVMHGLNEHSGRYDHLARRLNDIGVKVYGMDWTGHGG
SDGLHGYVQSLDHAVSDLKMYLKKILAENPGLPCFCFGHSTGGGIILKAMLDPEVDSCVE
GIFLTSPAVRVQPAHPIIKVMAPVFALIAPRYQFTASHRNGPPVSRDPEALKAKYSDQLV
FTGSIRVRTGYEILRLTSYLQQHLHRITVPMLVMHGADDMVTDPQGSQKLYEEASSSDKS
LNLYNGLLHDLLIEPEKEKIMDNIVDWLSPRI
NT seq 1179 nt   +upstreamnt  +downstreamnt
atggcggggagcatgcaggccgcggaggcggcggggcggatcagcgcgctgctgtcgctg
ctcgcgctgcggcggctcatcgccttgctccagccgctcgccctgctcctgctcctgccc
ttccggtggcgcggcgcgcgccccggcgccgccgccgcggcggcggcggcggcggcggac
gccgtggccgcctcggtcgcgtcgggcgggaagaaggggaaggccgccgtcgtgctgcgg
gtccccgccgggtcgccgatcgtcgccgcgaggcgccaggcgtcggcccgccgggagatc
gccgcgcggcgggcgcgcgaggccggccgcgagtacgagctcatccccacccaccgcggc
gagacgctgttcacgcagtgctggtggcctcacggatcctcctccgccattaagccgagg
gcgctcgtcgtagtcatgcacgggttgaacgagcacagtgggagatacgatcatctagct
aggaggttgaacgacatcggtgttaaggtttatgggatggactggactggtcatggtgga
agtgatggtcttcatggttacgtgcaatctcttgaccatgctgtcagtgacttgaaaatg
tatctcaagaaaattttagctgaaaaccctggtcttccatgcttctgttttggccactca
actggtggaggcatcattttgaaggctatgcttgatccagaggtagattcttgtgttgag
ggcatcttcctgacatcaccagctgttcgtgttcagcctgcccatccaatcataaaggtc
atggcccctgtgtttgccctcatagccccaagataccagttcacggcttcacacaggaac
gggccaccggtatcacgtgacccggaagccctgaaggctaaatattcagaccagcttgtg
ttcaccggttccatccgagttagaacagggtacgagatcctacgcctgacgtcgtatttg
caacagcacttgcacagaatcactgtcccgatgctggtgatgcatggtgccgatgatatg
gtgaccgatccccaaggatcacagaaactgtacgaagaagcttcatcctcggacaagtcc
ctcaatctgtacaacggtctgcttcatgatctgctcatcgagcccgagaaggagaagatc
atggacaacattgtggattggctgagcccgaggatttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343627
Entry
4343627           CDS       T01015                                 
Name
(RefSeq) caffeoylshikimate esterase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa01100  Metabolic pathways
Module
osa_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4343627
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    4343627
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     4343627
Peptidases and inhibitors [BR:osa01002]
 Serine peptidases
  Family S33
   4343627
SSDB
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Peptidase_S9 AXE1 Peptidase_S15 Abhydrolase_3 Abhydrolase_11 FSH1 Esterase
Other DBs
NCBI-GeneID: 4343627
NCBI-ProteinID: XP_015644703
UniProt: A0A0P0X821 Q8H4S9
LinkDB
Position
7:complement(22693190..22694669)
AA seq 334 aa
MPDGERHEEAPDVNFWGEQPATEAEYYAAHGADGESSYFTPPGGRRLFTRAWRPRGDGAP
RALVFMVHGYGNDISWTFQSTAVFLARSGFACFAADLPGHGRSHGLRAFVPDLDSAIADL
LAFFRSVRRREEHAGLPCFLFGESMGGAICLLIHLRTPPEEWAGAVLVAPMCKISDRIRP
PWPLPQILTFVARFAPTLAIVPTADLIEKSVKVPAKRLIAARNPMRYSGRPRLGTVVELL
RATDELGARLGEVTVPFLVVHGSADEVTDPDISRALYDAAASKDKTIKIYDGMMHSMLFG
EPDENIERVRADILAWLNERCTPREEGSFLTIQD
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgccggacggcgagcggcatgaggaggccccggatgtgaacttctggggcgagcagccg
gcgacggaggctgagtactacgcggcgcacggcgcggatggcgagtcgtcctacttcacc
ccgccgggcgggcgccgcctcttcacgcgggcgtggcggccccgtggcgacggcgcgccg
cgggcgctcgtgttcatggtgcacggctacggcaacgacatcagctggacgttccagtcc
acggccgtcttcctcgcccgctccggcttcgcctgcttcgccgccgacctccccggccat
ggccgctcccacggcctccgcgcgttcgtccccgacctcgattccgccatcgccgacctg
ctcgccttcttccgctccgtccggcggcgggaggagcacgccgggctgccgtgcttcctg
ttcggggagtccatgggcggggccatctgcctcctcatccacctccgcacgccgccggag
gagtgggccggcgccgtgctggtggcgcccatgtgcaagatctccgaccggatccgcccg
ccatggccgctgccgcagatcctcaccttcgtcgcccgcttcgcgcccacgctcgccatc
gtccccaccgccgacctcatcgagaagtccgtcaaggtgccggccaagcgcctcatcgcc
gcgcgcaaccccatgcgctatagcggccggccgaggctcggcaccgtcgtcgagctgctg
cgcgccaccgacgagctcggcgcccgcctcggcgaagtcaccgtcccgttcctcgtcgtg
cacggcagcgccgacgaggtgaccgacccggacatcagccgcgcgctgtacgacgccgcc
gccagcaaggacaagaccatcaagatatacgacgggatgatgcactccatgctcttcggg
gagcctgacgagaacatcgagcgcgtccgcgctgacattctcgcgtggctcaacgagaga
tgcacgccgagggaggagggcagcttcctgacaatacaagattag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346971
Entry
4346971           CDS       T01015                                 
Name
(RefSeq) monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa01100  Metabolic pathways
Module
osa_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4346971
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    4346971
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     4346971
Peptidases and inhibitors [BR:osa01002]
 Serine peptidases
  Family S33
   4346971
SSDB
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 LIDHydrolase Adeno_terminal FSH1 Ser_hydrolase
Other DBs
NCBI-GeneID: 4346971
NCBI-ProteinID: XP_015651209
UniProt: A3BYJ4 A0A8J8Y6C4
LinkDB
Position
9:complement(13695389..13699849)
AA seq 397 aa
MWAPTASPAAAAGRAAIPSLRRWPAAAAGVRIVVAVAPVKARAPRRLRLCLAVPPPASEM
AAAAAAAEEEEEEEEEEEGWSKAVELDAAARREMAIRRLQEEAGTGSSRREFAVFETARG
DALFTQSWTPVAAADRVKGIVVLLHGLNEHSGRYNHFAKLLNDHGLKVYAMDWIGHGGSD
GVHGYVSSLDHAVGDLKEFLEDVVLEENYGLPCFLFGHSTGGAIVLKAVLDPCVEVHVEG
VILTSPAIHVQPSHPIIKVVAPIFSVLAPKYRVAALHRRGPPVSRDPEALKIKYADPLVY
TGPIRVRTGNEILRISSYLQRNLSRVTVPFLVLHGTADTITDPGASQRLYQSSASAHKSI
KLYDGYLHDLLFEPERDDIANDIINWLSSRLDVLQRW
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgtgggcccccacggcctcgccggcggctgcggcggggagggcggcgatcccgtcgctc
cggcggtggccggcggcggccgcgggggtgcggatcgtcgtcgcggtggctcctgtcaag
gcgagggcgccgcggcggctgcggctctgcctcgcggtgccgccgcccgcgtccgagatg
gccgcggcggcggcggcggcggaggaggaggaggaggaggaggaggaggaggaggggtgg
agcaaggcggtggagctggacgcggcggcgaggcgggagatggcgatccggaggctgcag
gaggaggcggggacggggagcagcaggagggagttcgccgtgttcgagacggccaggggg
gacgctctcttcacgcagtcgtggaccccggtcgccgccgccgatcgcgtcaagggcatc
gttgttctgttacatggactaaatgagcatagtgggaggtacaaccattttgcaaagctg
ttaaatgatcatgggcttaaagtttatgcaatggactggattggacatggtggaagtgat
ggggtgcatggctatgtttcatcgcttgatcatgctgttggtgacctgaaagaatttcta
gaggatgttgtactggaggaaaactatggtttgccatgtttcttatttggccactccaca
ggtggagctattgttttgaaggcagtcctggatccttgtgttgaagttcatgttgaaggt
gtgatcttgacatctccggctattcatgttcaaccatctcatccaattatcaaagttgtt
gcacctatcttctctgtgttagctccaaaataccgagttgctgctttgcacaggagagga
cctcctgtttcccgtgatcctgaggctttgaagatcaagtatgcagatccacttgtgtat
actggacccattagagttagaactggcaatgaaattcttcggatatcatcatatttgcaa
agaaacttaagcagagtaactgtcccttttttagttctgcatggcacagctgacacaata
actgaccccggagcatctcaacgactgtaccaatcatcagcatcagcacataaatctata
aaactgtatgatggatatttacatgatcttctctttgaacctgaaagggatgatatagca
aatgacatcatcaattggttaagctcaagacttgatgttctccagagatggtga

DBGET integrated database retrieval system