KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327295
Entry
4327295           CDS       T01015                                 
Name
(RefSeq) UDP-glucuronic acid decarboxylase 4
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4327295
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     4327295
SSDB
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD NAD_binding_4 RmlD_sub_bind Polysacc_synt_2 adh_short KR TrkA_N
Other DBs
NCBI-GeneID: 4327295
NCBI-ProteinID: XP_015620898
UniProt: Q75PK7 Q656H5
LinkDB
Position
1:complement(11906855..11910917)
AA seq 425 aa
MASELTYRGGAGAPGSASDGGEYSPKPSKPLSWLTRAARYAAAEHRPAFALAGMLLAAAL
FSLYAPSSDASSSAATTTTTTFSHLSSLPSSSAASLHESAGGKVPLGLRRRALRVLVTGG
AGFVGSHLVDRLVERGDSVIVVDNFFTGRKDNVAHHLANPRFEVIRHDVVEPILLEVDQI
YHLACPASPVHYKYNPIKTIKTNVVGTLNMLGLAKRIGAKFLLTSTSEVYGDPLQHPQVE
TYWGNVNPIGVRSCYDEGKRTAETLTMDYHRGANLEVRIARIFNTYGPRMCIDDGRVVSN
FVAQALRKEPLTVYGDGKQTRSFQYVSDLVEGLMSLMEGEHIGPFNLGNPGEFTMLELAK
VVQDTIDPNARIEFRPNTADDPHKRKPDITRAKELLGWEPKVPLREGLPLMVTDFRKRIF
GDQEA
NT seq 1278 nt   +upstreamnt  +downstreamnt
atggcgtcggagctcacgtaccgcggcggcgcgggggccccgggctccgcctccgacggc
ggggagtactcccccaagccctccaagccgctctcctggctcacccgcgccgcccgctac
gccgccgccgagcaccgccccgccttcgccctcgccgggatgctcctcgccgccgccctc
ttctccctctacgccccttcctccgacgcctcatcctccgccgccaccaccaccaccacc
accttcagccacctctcctcgctcccgtcgtcgtcggcggcgtcgctgcacgagtccgcc
ggggggaaggtgccgctgggcctccgccgccgcgcgctgcgggtgctcgtcacgggcggc
gccgggttcgtcgggagccacctcgtggaccgcctggtggagcgcggcgacagcgtgatc
gtcgtcgacaacttcttcacggggcgcaaggacaacgtggcgcaccacctcgccaacccg
cgattcgaggtgatccgccacgacgtcgtcgagcccatcctgctcgaggtcgaccagatc
taccacctcgcctgccccgctagccccgtgcactacaagtacaaccccatcaagaccatc
aagaccaacgtggttgggacactgaacatgcttggattggccaagaggattggggcaaaa
tttctcctcaccagcaccagtgaggtatatggagatcccctccagcaccctcaggtggag
acttactggggcaatgtcaaccccattggtgttagaagctgctatgatgagggcaagcgc
acagctgaaacgttgaccatggattaccaccgtggtgccaaccttgaggtgaggattgct
cggatttttaacacatatggtcctcgcatgtgcattgatgatggccgtgttgtcagcaac
tttgttgctcaggcactgaggaaggaacctttgactgtctatggtgatggcaagcagact
aggagctttcaatatgtctctgatttggtggaagggttgatgagcttgatggaaggggag
cacataggaccatttaacctgggtaatccgggtgagttcaccatgctggagctggctaag
gttgtccaggacaccattgatccgaatgctcgcattgagttccgtccgaacactgcggat
gatccacacaagcgcaagcctgacatcacccgtgcgaaagagctcctgggctgggagccc
aaggttcccctgcgtgagggccttcccctcatggttaccgacttccgcaaacgcatcttt
ggcgaccaggaagcctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327367
Entry
4327367           CDS       T01015                                 
Name
(RefSeq) UDP-glucuronic acid decarboxylase 1
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4327367
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     4327367
SSDB
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD NAD_binding_4 RmlD_sub_bind Polysacc_synt_2 adh_short KR
Other DBs
NCBI-GeneID: 4327367
NCBI-ProteinID: XP_015621250
UniProt: Q0JHX7 Q8W3J1
LinkDB
Position
1:35896979..35900576
AA seq 410 aa
MKQLHKSSPTHAPAAAHAPASKASKASRPGPRSWVGYLLREQRLLFVLLGALIASSFFLL
RPYLFSLSPSSHVPDRRPLFSFASHTSSASGVPPGFRPPPRRVVVTGGAGFVGSHLVDRL
LEQGDSVIVVDNFFTGRKDNVAHHLRNPRFELLRHDVVEPILLEVDRIYHLACPASPVHY
KYNPIKTIKTNVMGTLNMLGLAKRIGARFLLTSTSEVYGDPLEHPQKETYWGHVNPIGVR
SCYDEGKRTAETLTMDYHRGGGVEVRIARIFNTYGPRMCLDDGRVVSNFVAQALRRQPMT
VYGDGKQTRSFQYVSDLVAGLMALMEGDHIGPFNLGNPGEFTMLELAQVVKETIDPMATI
EFKPNTADDPHMRKPDITKAKHLLRWEPKVSLREGLPLMVKDFRQRILDE
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgaagcagctccacaagtcgtcccccacccacgcgccggcggcggcgcacgccccggcg
tccaaggcgtccaaggcgtcccgccccgggccccgatcctgggtcggctacctcctccgc
gagcagcgcctcctcttcgtcctcctcggcgccctgatcgcctcctccttcttcctcctc
cgcccctacctcttctccctctccccgtcctcccacgtccccgaccgccgcccgctcttc
tccttcgcctcgcacacctcgtcggcgtcgggcgtgccccccgggttccgcccgccgccg
cgccgcgtcgtcgtcaccggaggggccgggttcgttggcagccacctcgtcgacaggctg
ctggagcaaggggacagcgtgatcgtggtggacaacttcttcaccgggaggaaggacaac
gtcgcgcaccacctccggaaccccaggttcgagctgctccgccacgatgtcgtcgagccc
atcctgctcgaggtggaccggatctatcacctcgcgtgccccgcgtcccctgtgcactac
aagtacaaccccatcaagacgatcaagaccaatgtcatgggaaccttgaatatgttgggt
ctggcaaagcgaattggtgcaaggttcttgctaactagcacaagtgaagtttatggagat
ccacttgaacatccacagaaggagacttactgggggcatgttaatcctattggtgttagg
agctgttatgacgaggggaaaagaacagcagagactttaaccatggactatcacagaggt
ggtggtgttgaggtgcgcattgctcgcattttcaatacatatggccctcgaatgtgtcta
gatgatggccgtgtggttagcaattttgttgcccaggcattgcgtagacagcctatgaca
gtttatggtgatggaaaacaaactagaagttttcagtatgtttctgatctggttgctgga
ctgatggctctgatggagggtgatcacattggccctttcaacctgggaaacccaggagaa
ttcaccatgttggaacttgcacaggttgtgaaggaaacaattgacccaatggcaacaatt
gaattcaaacccaacacagctgatgatcctcacatgagaaagccagatattaccaaggcc
aagcacctgctacgttgggagccaaaggtctctctcagggaaggtcttcccttaatggtg
aaggacttccgtcaaagaattttggatgagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332424
Entry
4332424           CDS       T01015                                 
Name
(RefSeq) UDP-glucuronic acid decarboxylase 6
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4332424
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     4332424
SSDB
Motif
Pfam: GDP_Man_Dehyd Epimerase Polysacc_synt_2 NAD_binding_4 3Beta_HSD RmlD_sub_bind NAD_binding_10 adh_short KR
Other DBs
NCBI-GeneID: 4332424
NCBI-ProteinID: XP_015632111
UniProt: Q8W3J0 A3AGL5
LinkDB
Position
3:9436488..9440587
AA seq 350 aa
MAQKEANGSSNGEHTTRPPPTPSPLRFSKFFQANLRILVTGGAGFIGSHLVDKLMENEKH
EVIVADNFFTGSKDNLKKWIGHPRFELIRHDVTQPLLVEVDQIYHLACPASPIFYKHNPV
KTIKTNVIGTLNMLGLAKRVGARILLTSTSEVYGDPLEHPQTEAYWGNVNPIGVRSCYDE
GKRVAETLMFDYHRQHGIEIRIARIFNTYGPRMNIDDGRVVSNFIAQAVRGEPLTVQKPG
TQTRSFCYVADMVNGLIKLMNGDNTGPINLGNPGEFTMLELAENVKELINPEVTVTMTEN
TPDDPRQRKPDITKAKEVLGWEPKIVLRDGLVLMEDDFRERLQVPKKNQA
NT seq 1053 nt   +upstreamnt  +downstreamnt
atggcgcagaaggaggccaatggcagcagcaacggggagcacaccacccgcccgccgccg
acgccctcgccgctccggttctccaagttcttccaggcgaacctgaggatcctcgtcacc
ggcggagctggcttcatcggctcgcacctcgtcgacaagctcatggagaacgagaagcac
gaggtcattgtcgcagacaactttttcactggttcaaaagacaacctgaagaagtggatc
ggacacccaagatttgagctaatccgtcatgatgtcacccagcccctgcttgtggaggtt
gaccaaatctatcaccttgcttgccctgcttcaccaatcttctacaagcacaaccctgtc
aagaccatcaagacaaacgttatcggaaccctgaacatgcttggacttgccaagagagtt
ggagctaggattttgttgacttcgacctctgaagtttacggtgatccgcttgagcaccct
caaacagaggcctactggggaaatgttaacccaattggagtcaggagttgctatgacgag
ggtaagcgtgtcgcagaaacactgatgtttgactatcacaggcagcatggcattgagatc
cgaattgccaggattttcaacacctatggacctaggatgaacattgatgatgggcgtgtt
gttagtaacttcattgctcaggccgtacgtggcgagcccctgactgttcagaagccagga
acacaaactaggagcttctgctatgttgctgacatggttaatggtcttattaagctgatg
aacggggacaacactggaccaattaatttgggaaacccaggtgaattcaccatgctggaa
cttgctgagaatgtgaaggagttgatcaacccagaggttaccgtcacaatgactgagaac
actcctgatgatcctcgtcagaggaagccagacattacaaaggcaaaggaagttttgggg
tgggagcccaagatcgttctgcgtgatggcttggtgctcatggaagatgatttccgggag
cgcctccaagtgcccaagaagaaccaggcctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332441
Entry
4332441           CDS       T01015                                 
Name
(RefSeq) UDP-glucuronic acid decarboxylase 1
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4332441
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     4332441
SSDB
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD NAD_binding_4 RmlD_sub_bind Polysacc_synt_2 NAD_binding_10 TrkA_N adh_short
Other DBs
NCBI-GeneID: 4332441
NCBI-ProteinID: XP_015630554
UniProt: B7EIS5
LinkDB
Position
3:complement(9600669..9603588)
AA seq 419 aa
MKQLNRQPTLSKQHRPHHHRLPLPRSLASYLLREHRLLFVLLGFLLASSCFLIYPSFTPL
SSSSSPRDTVAARIRRGGGGGGGASSVVVSAAAAASRRLPVGVRKPPLRVVVTGGAGFVG
SHLVDELLARGDSVIVVDNFFTGRKENVARHLADPRFELIRHDVVEPILLEVDQIYHLAC
PASPVHYKFNPIKTIKTNVMGTLNMLGLAKRVGARFLLTSTSEVYGDPLEHPQKESYWGH
VNPIGVRSCYDEGKRTAETLTMDYHRGAGVEVRIARIFNTYGPRMCLDDGRVVSNFVAQT
LRKQPMTVYGDGKQTRSFQYVSDLVDGLITLMESEHIGPFNLGNPGEFTMLELAQVVKET
IDPSARVEFKPNTADDPHMRKPDISKAKSLLHWEPKISLKQGLPRMVSDFQKRIMDEKR
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgaagcagctcaaccgccagcctaccctcagcaagcagcaccgcccgcaccaccaccgc
ctccccctcccccgctccctcgcctcctacctcctccgcgagcaccgcctcctcttcgtc
ctcctcggcttcctcctcgcctcctcctgcttcctcatctacccctccttcacccctctc
tcctcctcctcctcaccccgcgacaccgtcgccgccagaatccgtcgtggcggcggcggc
ggcggtggcgcgtcgtccgtcgtcgtctccgccgccgccgccgcctcgcgccgcctcccc
gtcggcgtccgcaagccacccctccgcgtcgtcgtcacggggggagcgggcttcgtcggc
agccacctcgtcgacgagctgcttgcccgcggggacagcgtcatcgtcgtcgacaacttc
ttcacggggcgcaaggagaacgtcgcgcgccacctcgccgacccgcggttcgagctcatc
cgccacgacgtcgtcgagcccatcctcctcgaggtcgaccagatctaccacctcgcctgc
ccggcatcccccgtccactacaaattcaaccccatcaagaccatcaagacaaatgtgatg
gggaccttgaacatgctgggattggcaaagagggtgggagcccggttcttattgaccagt
accagtgaggtgtacggtgatcctcttgaacatccacagaaggagagctactggggccat
gtaaatcccataggcgttaggagttgttacgacgagggcaagagaacagctgagactctg
accatggattaccatcgaggtgccggtgttgaggtgagaattgcgcgaatattcaacaca
tatggccctcgtatgtgtttagatgatgggcgagttgttagcaacttcgtcgctcagaca
ttgcggaaacagccaatgacagtttatggtgatggaaagcagactagaagttttcaatat
gtttcagatttggttgatggattgataaccctgatggaaagtgagcatataggacctttc
aacttgggaaatcctggagaatttaccatgttagagcttgctcaggtagtgaaagagaca
attgacccaagtgctcgtgttgagttcaaacccaatactgcagatgatccacacatgaga
aaaccagacatctcgaaggccaaatctcttctccattgggagccaaaaatctcactgaag
caaggcctgccacgtatggtttcagacttccagaagcgcatcatggatgagaaaagataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338546
Entry
4338546           CDS       T01015                                 
Name
(RefSeq) UDP-glucuronic acid decarboxylase 2
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4338546
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     4338546
SSDB
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD NAD_binding_4 RmlD_sub_bind Polysacc_synt_2 adh_short KR
Other DBs
NCBI-GeneID: 4338546
NCBI-ProteinID: XP_015639298
UniProt: Q6I683 Q0DIU1
LinkDB
Position
5:complement(17343461..17347641)
AA seq 447 aa
MASELTYRGGGGATLAGEAEAAVAAGGYSPKPSKPLAWLPRAARYAAGEHRPLFALAGML
VAAAIFSLATPYSSSTPAAAAAGSTAANPLARFSVEPAVSRRQQQLPARQFVGGKVPLGL
KRKGLRVLVTGGAGFVGSHLVDRLVERGDSVIVVDNLFTGRKENVVHHFGNPNFEMIRHD
VVEPILLEVDQIYHLACPASPVHYKYNPVKTIKTNVVGTLNMLGLAKRINARFLLTSTSE
VYGDPLQHPQVETYWGNVNPIGVRSCYDEGKRTAETLTMDYHRGANLEVRIARIFNTYGP
RMCIDDGRVVSNFVAQALRKEPLTVYGDGKQTRSFQYVSDLVEGLMRLMEGEHVGPFNLG
NPGEFTMLELAKVVQDTIDPNAKIEFRPNTQDDPHKRKPDIGRAKELLGWEPKIPLHKGL
PLMVTDFRKRIFGDQDSTATTTGGQQG
NT seq 1344 nt   +upstreamnt  +downstreamnt
atggcgtcggagctgacctaccgcggcggcggcggcgcgacgctggccggcgaggcggag
gcggcggtagcggcgggggggtactccccgaagccgtccaagccgctcgcgtggctcccc
cgcgccgcccggtacgccgccggcgagcaccgcccgctcttcgccctcgccgggatgctc
gtcgccgctgccatcttctccctcgccaccccgtactcctcctccacccccgccgccgcg
gccgccggttcaaccgcggcgaacccgctggcgcggttctcggtggagccggcggtgagc
cggcggcagcagcagctgccggcgaggcagttcgtgggcgggaaggtgccgctggggctg
aagcggaaggggctccgggtgctggtgaccggcggcgccgggttcgtggggagccacctg
gtggaccggctggtggagcgcggcgacagcgtgatcgtggtggacaacctgttcacgggg
cggaaggagaacgtggtgcaccacttcggcaacccaaacttcgagatgatccgccacgac
gtcgtcgagcccatcctcctcgaggtcgaccagatctaccacctcgcctgccccgcttcc
cccgttcactacaagtacaaccccgtcaagacaatcaagaccaatgtggttgggactctc
aacatgctcggattggcgaagaggatcaatgccaggttcctcctcaccagcaccagtgag
gtctacggtgatcccctgcagcatcctcaagtggagacttactggggcaatgtcaacccc
attggtgtgaggagttgttacgatgagggcaagcgcacagctgaaactttgaccatggac
tatcaccgtggtgccaaccttgaggttaggatcgctcgtatcttcaacacatatggccct
cgcatgtgcatcgatgatggccgtgttgtcagcaactttgttgctcaggctttgaggaag
gagcctttgacggtttacggtgatggcaagcagaccaggagtttccaatatgtctctgat
ctggttgagggattgatgaggctcatggaaggtgagcacgtagggccattcaacctgggt
aaccctggtgagttcaccatgctggagctggccaaggttgtccaggacaccatcgaccct
aacgcaaagatcgagttccgtcccaacacccaggacgacccgcacaagcgcaagcctgac
atcggccgtgccaaggagctccttgggtgggagccaaagatccctctccacaagggtctt
cccctcatggtcaccgacttccgcaagcgcattttcggtgaccaagacagcaccgccaca
accaccggaggccaacaagggtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344260
Entry
4344260           CDS       T01015                                 
Name
(RefSeq) UDP-glucuronic acid decarboxylase 2
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4344260
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     4344260
SSDB
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD NAD_binding_4 RmlD_sub_bind Polysacc_synt_2 adh_short
Other DBs
NCBI-GeneID: 4344260
NCBI-ProteinID: XP_015647595
UniProt: Q0D3P7 Q6F3E9
LinkDB
Position
7:28494701..28498072
AA seq 445 aa
MAGSSSELIYRRGHDAQPAAGDVDGCGVMAAAGYSSSAKPPHKPPLGPLRYLLAEQRLVF
ALVGMAIASLVFLLAAPSSGNGGRHEVMNGGAARLAAAGLAVRQYSGVAAAAAGARVPLG
LKKKGLRVVVTGGAGFVGSHLVDRLLARGDSVMVVDNLFTGRKENVLHHAGNPNFEMIRH
DVVEPILLEVDQIYHLACPASPVHYKHNPVKTIKTNVVGTLNMLGLAKRVGARFLLTSTS
EVYGDPLQHPQVETYWGNVNPIGVRSCYDEGKRTAETLTMDYHRGANLEVRIARIFNTYG
PRMCIDDGRVVSNFVAQALRKEPLTVYGDGKQTRSFQYVSDLVEGLMKLMEGEHVGPFNL
GNPGEFTMLELAKVVQDTIDPNARIEFRPNTADDPHKRKPDISRAKELLGWEPKIPLHKG
LPLMVQDFRDRIFGDHKPHSVAGDN
NT seq 1338 nt   +upstreamnt  +downstreamnt
atggcgggctcctcctccgagctgatctaccgccgcggccacgacgcgcagccggccgcg
ggtgacgttgacggctgcggcgtgatggccgccgccgggtactcatcatcggccaagccg
ccgcacaagccaccactcggcccgctgcggtatctgctcgccgagcagcggctggtgttc
gcgctcgtcggcatggccatcgcgtcgctggtcttcctcctggcggctccgtcgtcgggg
aacggaggccgccacgaggtgatgaacggcggcgcggcgcggctggcggcggcggggctg
gcggtgcggcagtactccggcgtggcggcggcggcggcgggggcgcgcgtgccgctgggg
ctgaagaagaaggggctccgcgtggtggtgacggggggagccgggttcgtggggagccac
ctggtggaccggctgctggcgcgcggcgacagcgtgatggtggtggacaacctgttcacg
gggaggaaggagaacgtgctgcaccacgccggcaacccgaacttcgagatgatccggcac
gacgtcgtggagccgatcctcctggaggtggaccagatctaccacctggcgtgcccggcg
tcccccgtgcactacaagcacaaccccgtcaagaccatcaagaccaacgtcgtcggcacc
ctcaacatgctcggcctcgccaagcgcgtcggcgcccgcttcctcctcaccagcaccagc
gaggtctacggcgacccgctccagcacccccaggtcgagacctactggggcaacgtcaac
cccatcggggtgagaagctgctacgacgaggggaagaggacggcggagacactgaccatg
gactaccaccgtggcgccaacctcgaggtgaggattgctcggatcttcaacacctacggc
ccccgtatgtgcatcgacgatggccgggtcgtcagcaactttgtcgcccaggcactgagg
aaggagcccttgacggtgtacggcgacggtaagcagacgaggagcttccagtacgtctcc
gatctggtggaggggttgatgaagctgatggaaggggagcacgtagggccattcaacctg
ggaaacccaggggagttcacaatgctggagcttgccaaggtggtgcaggacaccatcgac
ccaaacgcgcggatcgagttcaggccgaacaccgccgacgacccgcacaagcggaagccg
gacatcagccgcgccaaggagctcctcggctgggagcccaagatccccctccacaagggc
ctcccgctcatggtccaggacttccgcgaccgcatcttcggcgaccacaagccccactcc
gtcgccggcgacaactga

DBGET integrated database retrieval system