KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327327
Entry
4327327           CDS       T01015                                 
Name
(RefSeq) ectonucleotide pyrophosphatase/phosphodiesterase family member 1
  KO
K01513  ectonucleotide pyrophosphatase/phosphodiesterase family member 1/3 [EC:3.1.4.1 3.6.1.9]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa00240  Pyrimidine metabolism
osa00500  Starch and sucrose metabolism
osa00740  Riboflavin metabolism
osa00760  Nicotinate and nicotinamide metabolism
osa00770  Pantothenate and CoA biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4327327
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4327327
   00240 Pyrimidine metabolism
    4327327
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    4327327
   00760 Nicotinate and nicotinamide metabolism
    4327327
   00770 Pantothenate and CoA biosynthesis
    4327327
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:osa04090]
    4327327
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:osa00537]
    4327327
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.1  phosphodiesterase I
     4327327
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.9  nucleotide diphosphatase
     4327327
CD molecules [BR:osa04090]
 Proteins
  4327327
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:osa00537]
 Enzymes
  4327327
SSDB
Motif
Pfam: Phosphodiest Sulfatase DUF229
Other DBs
NCBI-GeneID: 4327327
NCBI-ProteinID: XP_015611443
UniProt: Q0JPW9 Q42974
LinkDB
Position
1:5218565..5220418
AA seq 479 aa
MAAAAAAAPPFAAGDSPPPTALLLPRTTTTTAGAAPAPRRSSASSRLHLLLTAALAVATS
YLLLILPRTPLSAAPAPAAAARAQVKLEKPVVILISSDGFRFGYQHKAATPHIHRLIGNG
TSAATGLVPIFPTLTFPNHYSIATGLYPSSHGIINNYFPDPISGDYFTMSSHEPKWWLGE
PLWVTAADQGIQAATYFWPGSEVKKGSWDCPDKYCRHYNGSVPFEERVDAILGYFDLPSD
EMPQFLTLYFEDPDHQGHQVGPDDPAITEAVVRIDEMIGRLIAGLEERGVFEDVNVILVG
DHGMVGTCDKKLVFLDELAPWIKLEEDWVLSMTPLLAIRPPDDMSLPDVVAKMNEGLGSG
KVENGEYLRMYLKEDLPSRLHYADSYRIPPIIGLPEEGYKVEMKRSDKNECGGAHGYDNA
FFSMRTIFIAHGPRFEGGRVVPSFENVEIYNVIASILNLEPAPNNGSSSFPDTILLPSE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggctgctgctccgcccttcgccgccggcgactcgccgcccccgacc
gccttgctcctcccccgcaccaccaccaccaccgccggcgccgcccccgcgccccggcgt
tcctccgcctcctcccgcctccacctcctcctcaccgccgcgctcgccgtcgcgacctcc
tacctcctcctcatcctcccccgcacgcccctctccgccgcgccggcgcctgcggccgcc
gcgcgggcgcaggtgaagctcgagaagccggtggtgatcctcatctcctccgacgggttc
cgcttcgggtaccagcacaaggccgcgaccccgcacatccaccgcctcatcggcaatggc
acctccgccgccacgggcctcgtccccatcttccccacgctcacgttccccaatcactac
tccatcgccaccggcctctacccttcctcccacggcatcatcaacaactacttccccgac
ccaatctccggcgactacttcaccatgtcctcgcatgaacccaagtggtggctcggggag
cccctgtgggtcaccgccgccgaccagggtatccaggccgccacctacttctggcccggc
tcggaggtgaagaaaggcagctgggattgtcccgacaagtattgccgccactacaatggc
tcggtaccattcgaggagagggtcgatgcgatccttggttactttgatctcccatctgat
gaaatgccgcagttcctgacgctttattttgaagatccagatcaccaggggcatcaggtg
ggtcctgatgacccggccatcacggaggcggtggtgcggatcgatgagatgattgggagg
ctcattgctggtctggaagaaagaggagtgtttgaggatgtcaatgttatattggttggt
gaccatgggatggttgggacttgcgacaagaagctggtgtttctcgacgaattggctcca
tggattaagttggaggaagattgggttttatcaatgaccccgttgctggccatcaggccg
ccagatgacatgtcgctgccagatgttgtggccaagatgaatgaagggcttgggtctggg
aaggtggagaatggtgaatatctaagaatgtacttaaaggaggatttgccttctcgactt
cactacgcagatagttatagaatcccaccgataattgggttgccagaggaagggtataaa
gtggagatgaagcgatcggacaaaaatgaatgtggaggagcacatggttatgacaatgcc
ttcttctcaatgagaaccatatttatcgcgcatggtcctcgttttgaaggtggtagagtc
gtgccatcctttgagaacgtggagatatacaacgttattgcttccattctcaatttggag
ccagctccaaacaatggttcatcttcttttcctgacacaattcttttgccgagtgaatga

DBGET integrated database retrieval system