KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327329
Entry
4327329           CDS       T01015                                 
Name
(RefSeq) cytochrome P450 90D2
  KO
K09589  steroid 3-oxidase [EC:1.14.-.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00905  Brassinosteroid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00905 Brassinosteroid biosynthesis
    4327329
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:osa00199]
    4327329
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     4327329
Cytochrome P450 [BR:osa00199]
 Cytochrome P450, plant type
  CYP90 family
   4327329
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 4327329
NCBI-ProteinID: XP_015611433
UniProt: Q94IW5
LinkDB
Position
1:5236198..5244553
AA seq 490 aa
MVSAAAGWAAPAFAVAAVVIWVVLCSELLRRRRRGAGSGKGDAAAAARLPPGSFGWPVVG
ETLEFVSCAYSPRPEAFVDKRRKLHGSAVFRSHLFGSATVVTADAEVSRFVLQSDARAFV
PWYPRSLTELMGKSSILLINGALQRRVHGLVGAFFKSSHLKSQLTADMRRRLSPALSSFP
DSSLLHVQHLAKSVVFEILVRGLIGLEAGEEMQQLKQQFQEFIVGLMSLPIKLPGTRLYR
SLQAKKKMARLIQRIIREKRARRAAASPPRDAIDVLIGDGSDELTDELISDNMIDLMIPA
EDSVPVLITLAVKFLSECPLALHQLEEENIQLKRRKTDMGETLQWTDYMSLSFTQHVITE
TLRLGNIIGGIMRKAVRDVEVKGHLIPKGWCVFVYFRSVHLDDTLYDEPYKFNPWRWKEK
DMSNGSFTPFGGGQRLCPGLDLARLEASIFLHHLVTSFRWVAEEDHIVNFPTVRLKRGMP
IRVTAKEDDD
NT seq 1473 nt   +upstreamnt  +downstreamnt
atggtgtcggcggccgccggttgggcggcgccggcgtttgcggtcgccgccgtggttatt
tgggtggtgctgtgtagtgagctcctgcggaggcggcggcgtggtgcaggcagcggcaag
ggggacgcggcggcggcggcgcgcctcccgccggggagcttcgggtggccagtggtgggc
gagacgctggagttcgtgtcgtgcgcctactcgccgcgccccgaggcgttcgtcgacaag
cgccggaagctgcacgggagcgcggtgttcaggtcgcacctgttcgggtcggcgacggtg
gtgacggcggacgcggaggtgagccggttcgtgctgcagagcgacgcgcgggcgttcgtg
ccgtggtacccgcggtcgctgacggagctgatgggcaagtcctccatcctcctcatcaac
ggcgcgctccagcgacgcgtccacggcctcgtcggcgccttcttcaagtcctcccacctc
aagtcccagctcaccgccgacatgcgccgccgcctctcccccgccctctcctccttcccc
gactcctccctcctccacgtccagcacctcgccaagtcggtggtgttcgaaatcctggtg
aggggcctgatcgggctggaggcaggggaggagatgcagcagctgaagcagcaattccag
gaatttattgtcggcctcatgtccctccccattaagctgcctggcactaggctctacaga
tcactccaggccaagaagaagatggcgaggctgatacagaggatcatccgggagaagagg
gcaaggagggccgccgcctcgccgccgcgggacgccatcgacgtgctcatcggagacggc
agcgatgagctcaccgacgagctcatctccgacaacatgatcgacctcatgatccccgcc
gaggactccgtcccggtgctcatcacgctcgccgtcaagttcctcagcgagtgccctctc
gccctgcaccaactggaagaggagaacatacagctcaagaggcgaaaaaccgacatgggt
gagaccttgcaatggacagactacatgtcattgtcattcacacaacatgtgataacagag
acgctgcggttgggcaacatcatcggtgggatcatgcgcaaggcggtgcgcgacgtcgag
gtgaaggggcacctcatccccaaggggtggtgcgtgtttgtgtacttccggtcagtccac
ctcgatgatacgctctacgatgagccctacaagttcaacccatggaggtggaaggagaag
gacatgagcaatggcagcttcactccttttggtggtgggcagaggctgtgcccaggcctg
gatctggccaggctggaagcttccatcttccttcaccacttggtcaccagcttcaggtgg
gtggcggaggaggaccacatcgtcaacttccccaccgtgcggctcaagcggggcatgccc
atcagggtcaccgccaaggaggacgacgactag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9266092
Entry
9266092           CDS       T01015                                 
Name
(RefSeq) cytochrome P450 90D2-like isoform X1
  KO
K09589  steroid 3-oxidase [EC:1.14.-.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00905  Brassinosteroid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00905 Brassinosteroid biosynthesis
    9266092
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:osa00199]
    9266092
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     9266092
Cytochrome P450 [BR:osa00199]
 Cytochrome P450, plant type
  CYP90 family
   9266092
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 9266092
NCBI-ProteinID: XP_015639829
LinkDB
Position
5:6267731..6273104
AA seq 587 aa
MFFVHYWLTTSIYIEVIKYIYRFCIYRYTFIYMHSIYIDAHLLFQKLEYSILTVTQLATP
AAMQPLAAGGGVSWPLYAATVAAALLVTAIVLRLAARSTAAACKARPPAGSLGWPLVGET
LQFISAAYSSRPESFVEKRCRRYGKVFRSHLWGSPAVVSADAEASRAVLQSDASAFVPWY
PRSLMELMGESSILVLGGALQRRVHGLAGAFFKSPELKARVTADMRSRLAAAMDAWRATA
ATGAGAAVRVQDEAKLIVFEILVRALIGLEQGQEMNYLRQQFHIFIAGLISLPIKLPGTQ
LYRSLKAKKRMTSLIQNIIQEKRRRIFEGKDLCAVSRDLIDVLMSNGSDELSLTDELISD
NMIDFMIPAEDSVPVLITLAIKYLSECPLALQQLEEENMELKRQKSDVGETLEWTDYMSL
TFTQHVITETLRIGNIISGIMRKAVRDVEVKGQGDVVIPKGWCVLVYFRSVHLDANIYDD
PYAFNPWRWKERDMAAATANSGSGFTPFGGGQRLCPGLDLARLQTSIFLHHLVTNFTYVN
YTYLSGWHRGTSSSTSQQCGSNEECPSRSRPRHNMQISPDHLKVRGE
NT seq 1764 nt   +upstreamnt  +downstreamnt
atgttctttgttcactattggttgactacatctatatatatcgaagtaattaaatatata
tataggttttgtatctatagatacacattcatatatatgcactcgatatatatagacgca
catcttctcttccaaaagctggaatactcgatcctcacagtcacacagctagcaacgccg
gcggccatgcaaccactcgctgccggcggcggcgtctcttggccgttgtacgccgccacc
gtcgcggcggcgctgctcgtcaccgccatcgtcctgcggctcgccgcgcggtcgacggcg
gccgcctgcaaggcacgtccccccgccgggtctctcggctggccgctcgtcggcgagacg
ctgcagttcatctccgccgcctactcctcccgccccgagtccttcgtcgagaagcgctgc
cgccggtacgggaaggtgttcaggtcgcacctgtgggggtcgccggcggtggtgagcgcg
gacgccgaggcgagccgcgcggtgctgcagagcgacgcgtcggcgttcgtgccgtggtac
ccgaggtcgctgatggagctgatgggggagtcgtccatcctggtgctcggcggcgccctc
cagcgccgggtgcacggcctcgccggcgccttcttcaagtcgccggagctcaaggcccgg
gtcaccgccgacatgcgcagccgcctcgccgccgccatggacgcgtggcgcgccaccgcc
gccaccggcgccggcgcggccgtgcgcgtccaggacgaggccaagttgattgtttttgaa
atcttagtgagggcactgatagggttagagcaaggtcaggaaatgaattacctcaggcag
cagttccacatattcattgccggcctgatctccctgcccatcaagcttccagggactcag
ctctacagatccctcaaggctaagaagaggatgacaagtttgatacaaaatatcattcaa
gagaaaaggaggaggatctttgaaggcaaggatctctgcgctgtttcgcgcgacttgatc
gatgtgctgatgagcaacgggagcgacgagctcagcctcaccgacgagctgatatccgac
aatatgatcgacttcatgatccccgcagaggactccgtgccagtgctcatcacacttgcc
atcaagtacctcagcgaatgcccattggctttgcagcaactagaggaggagaacatggag
ctgaagaggcagaaatcagacgtgggcgaaaccctagagtggacagactacatgtcactg
acgttcacgcagcatgtaatcacggagaccctacggataggcaacatcatcagcgggata
atgaggaaggcagtaagggatgtggaggtgaaggggcagggtgacgtggtgatccccaag
gggtggtgtgtcctcgtttacttccgttctgtccacctagacgccaacatctacgacgac
ccctatgccttcaacccatggagatggaaagagagggacatggcggccgcgactgccaac
agtggtagcggcttcactccctttgggggcgggcaaaggctatgcccggggctagacttg
gccaggctccagacctccatctttctccaccacctcgtcactaatttcacgtatgtcaac
tatacctacctaagtgggtggcacagggggacgtcgtcgtcaacttcccaacagtgcggc
tcaaacgaggaatgcccatcaaggtcacgcccaagacataacatgcaaatcagtccagat
catttgaaggtgagaggagagtga

DBGET integrated database retrieval system