KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327373
Entry
4327373           CDS       T01015                                 
Name
(RefSeq) replication protein A 70 kDa DNA-binding subunit B-like
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
SSDB
Motif
Pfam: REPA_OB_2 DUF223 Rep_fac-A_C
Other DBs
NCBI-GeneID: 4327373
NCBI-ProteinID: XP_015621596
LinkDB
Position
1:35938434..35949996
AA seq 439 aa
MSAKMAFDLLCDISPASRGWKIRAKIARMWDYTGTADDLPPIHVDLVLIDEKGNAMYAEI
PGVEADKFRPLLQESKVYTFSKFLILPSKPAYKPFPNKYMIKLTPWTNVEQVNEVPADFP
SHVFNLVQFSYLSLRVGMQEYFTDVIGMIIGVSKLAYVRMASKTSDTPKRVIALRDLANC
EVKLVLWGEHAPDFDADAVHSVGQDNAVVGIFVDTLMKAYNNEETLSGGSACKWYLNEDI
PEINQFFDSLGDSAPKIQWISTGAESFGSSQRPARLEHKSVADLKKIDPWEAAGAGFSCT
VTIAKLSPSQSWWFSSCSRCHRAATAYGSSYKCSSGCSSVTAIPKYRLCLIGTDGTNSAE
FVLFGRVAQQVVGRPVMNLIKFQGRSDNIPKEIAAVVSQKFTFAVSVTERSLMHRNISFQ
VNGIETFFGRQGSIPQPRE
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgtcggctaagatggctttcgatttgctgtgtgacatatccccagcaagcagaggctgg
aagatccgtgcaaagatagcaagaatgtgggactacactggtacagctgacgatctgcct
cctatacatgttgatctggtgcttattgatgagaagggaaatgcaatgtatgctgaaatt
ccaggcgttgaggctgataagttcagaccacttcttcaggaatcgaaagtctacactttt
agcaagttccttattttgcctagcaaacctgcatacaagcccttccctaacaagtatatg
atcaagcttactccatggacaaacgtggaacaggtcaatgaagttcctgctgatttccca
tcccatgtgtttaatttggttcaattctcatatctaagcctgcgcgttgggatgcaagag
tacttcactgatgtgatcggtatgatcattggggtatcaaagctagcctatgtccgaatg
gcgtctaaaacgtcagacacacctaagagggtcattgctctaagggatcttgcgaactgt
gaggttaaacttgtcctatggggagagcatgctcccgactttgatgctgatgctgttcat
agtgttggccaagataatgctgtcgttggtatctttgttgatactcttatgaaagcatat
aataatgaagaaactcttagtggaggatcagcctgcaaatggtatttaaatgaggacata
ccagagataaaccagttctttgatagcctgggtgatagtgctccaaagatccagtggata
tcaaccggagcagagtcctttggttcgtcacaacgcccagcacggttggagcataaatct
gttgctgaccttaaaaagattgatccatgggaagctgcgggtgctggcttctcatgtact
gtgaccatagctaagttgagcccatctcagtcatggtggttttcatcctgttcccgttgt
catagagccgcaactgcatatggatctagctataaatgctccagcggttgctcatcagtt
actgccattccaaagtaccgtctttgcctgataggaaccgatggaactaattcagcagag
tttgtgctatttggacgtgttgcgcagcaagttgttggccgtcctgttatgaatcttatc
aaatttcagggcagatcagacaatattcctaaagaaattgctgctgttgtttcacagaaa
tttacctttgctgtctctgtcactgagcggagccttatgcacaggaatatatcttttcaa
gttaatggaatcgagactttctttggaagacagggttctattccgcagcctagggaatag

DBGET integrated database retrieval system