KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327386
Entry
4327386           CDS       T01015                                 
Name
(RefSeq) ubiquitin-conjugating enzyme E2 7
  KO
K10575  ubiquitin-conjugating enzyme E2 G1 [EC:2.3.2.23]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
osa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4327386
   04120 Ubiquitin mediated proteolysis
    4327386
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4327386
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     4327386
Ubiquitin system [BR:osa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   4327386
SSDB
Motif
Pfam: UQ_con RWD
Other DBs
NCBI-GeneID: 4327386
NCBI-ProteinID: XP_015618097
UniProt: A0A8J8XQ44 Q943L1
LinkDB
Position
1:complement(36017253..36023464)
AA seq 169 aa
MAATISQASLLLQKQLKDLAKHPVDGFSAGLVDDSNVFEWQVTIIGPPDTLYDGGYFNAI
MSFPQNYPNSPPTVRFTSEMWHPNVYPDGRVCISILHPPGDDPNGYELASERWTPVHTVE
SIVLSIISMLSGPNDESPANIEAAKEWREKRDDFKKKVRRLVRKSQEML
NT seq 510 nt   +upstreamnt  +downstreamnt
atggcggctaccatcagccaggcgagcctcctcctgcagaagcagctgaaagatctcgcg
aagcaccccgtggatgggttctcggctgggttagtcgacgacagcaacgtcttcgagtgg
caggtcacaatcatcggcccgcctgacaccctatatgatggaggttactttaatgcaata
atgagctttccacagaattatcctaacagtcctccaactgtcagatttacctcagaaatg
tggcatccaaatgtttatccggatggacgtgtatgcatttctattcttcatccgcctggt
gatgatcccaatggttatgagcttgcgagtgagcgttggacaccagtgcatacggttgag
agcatagttctgagcatcatttcgatgctttctggtccaaatgatgaatcaccagcaaat
attgaagcagctaaggaatggagagagaagagggatgacttcaagaaaaaggttaggcgc
cttgtaaggaaatcacaagaaatgctctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339013
Entry
4339013           CDS       T01015                                 
Name
(RefSeq) ubiquitin-conjugating enzyme E2 7
  KO
K10575  ubiquitin-conjugating enzyme E2 G1 [EC:2.3.2.23]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
osa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4339013
   04120 Ubiquitin mediated proteolysis
    4339013
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4339013
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     4339013
Ubiquitin system [BR:osa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   4339013
SSDB
Motif
Pfam: UQ_con RWD
Other DBs
NCBI-GeneID: 4339013
NCBI-ProteinID: XP_015640551
UniProt: Q6L508 B9FJH9
LinkDB
Position
5:22615848..22620171
AA seq 169 aa
MATAASQASLLLQKQLKDLAKNPVDGFSAGLVDDSNVFEWQVTIIGPPDTLYDGGYFNAI
MTFPQNYPNSPPSVRFTSEMWHPNVYPDGRVCISILHPPGEDPNGYELASERWTPVHTVE
SIVLSIISMLSSPNDESPANIEAAKDWREKRDDFKKKVRRIVRKSQEML
NT seq 510 nt   +upstreamnt  +downstreamnt
atggcgactgccgcgagccaggcgagcctcctgctccagaagcagctcaaagatctcgcg
aagaaccccgtggatgggttctcggcggggcttgtggacgatagcaacgtgttcgagtgg
caggtcaccatcatcggcccgcccgataccctgtatgatggaggctacttcaatgcaata
atgaccttcccccagaattatccgaatagtcccccatcagtaaggtttacctctgagatg
tggcatccaaatgtttatcctgatgggcgcgtatgcatttctatccttcatccacctggc
gaagatcccaacggttatgagcttgcgagcgaacggtggacacctgtgcatacagttgaa
agtatagttctgagcatcatttcgatgctctctagtccaaatgatgagtctccagcaaat
attgaagcggctaaggattggagagaaaagagggacgatttcaagaaaaaggttagacgc
attgttcgtaaatcacaggaaatgctctga

DBGET integrated database retrieval system