KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327435
Entry
4327435           CDS       T01015                                 
Name
(RefSeq) probable phytol kinase 2, chloroplastic
  KO
K15892  farnesol kinase [EC:2.7.1.216]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00900  Terpenoid backbone biosynthesis
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    4327435
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.216  farnesol kinase
     4327435
SSDB
Motif
Pfam: CTP_transf_1 GHMP_kinases_N
Other DBs
NCBI-GeneID: 4327435
NCBI-ProteinID: XP_015624995
UniProt: Q5N9J9
LinkDB
Position
1:complement(35601033..35604050)
AA seq 304 aa
MVSLISAHLLSLPSSAPRSRPQSRPPLSPPAAAAAASCSFDLPRPRRLVADGSRRKGTMA
AAIPPEASGLAHDLGSAAVTAGVALALLRFFEELAKRGVFEQKLNRKLVHITIGMVFLLF
WPLFSSGSYAPFLAAVAPGINIIRMLLLGLGVMKNEAMVKSMSRSGDPRELLKGPLYYAT
TITFATSIFWRTSPIAIALICNLCAGDGIADIVGRRLGQEKLPYNPNKSYAGSIAMALAG
FMASIGYMHYFQSFGFIEESWSLAFGFLVVSVTAALVESHPISTHLDDNLTVPLTSFLVG
SLVF
NT seq 915 nt   +upstreamnt  +downstreamnt
atggtcagtctcatcagtgcccatctcctctcgctaccctcatccgcgccgcgctctcgc
ccgcaatcgaggccgcccctctcgccgcccgccgccgccgccgccgcctcctgctccttc
gacctgccccggccccgccgcctcgtcgccgacgggagccggaggaaggggacgatggct
gcggcgatcccgcccgaggcaagcggcctggcccacgacctcgggtccgcggccgtcacc
gcaggcgtcgccctcgccctcctccgcttcttcgaggagctcgccaagcgcggggtcttc
gagcagaaactcaatagaaaacttgtgcatataactatcggtatggtattcttgctcttt
tggcctcttttcagctcaggaagctatgctcctttcctggctgcagtagcaccagggatt
aatattataaggatgcttctgctggggttaggagtaatgaaaaatgaagctatggtaaaa
tcaatgagccgatctggagacccgagggaacttctcaagggtccactgtattatgctacc
actataacttttgccacttctatattctggagaacctctccaatcgctatagcccttatt
tgcaacttatgtgctggggacggaatagcagacatagtggggagacgtcttggccaagaa
aagcttccatacaaccccaacaagtcatatgcaggcagcatagcaatggcactagctggt
ttcatggcttcaattgggtatatgcattacttccagtcattcggtttcattgaagaaagc
tggtccttggcttttggcttccttgttgtttctgtaactgcagcacttgtagagtcccat
cccatcagcacacatttggatgacaacttgactgttcctttaacatcattcctagttggt
agccttgttttctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349551
Entry
4349551           CDS       T01015                                 
Name
(RefSeq) probable phytol kinase 2, chloroplastic
  KO
K15892  farnesol kinase [EC:2.7.1.216]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00900  Terpenoid backbone biosynthesis
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    4349551
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.216  farnesol kinase
     4349551
SSDB
Other DBs
NCBI-GeneID: 4349551
NCBI-ProteinID: XP_015617280
UniProt: A0A8J8Y050 Q2RBN0
LinkDB
Position
11:complement(262575..264564)
AA seq 274 aa
MWILESPLLRDAGAAVLTGATALAVLRFWEEVGNRALLDQKLCRKLVHITVGLVYFLMWP
LFSADDVYAPFLASLVIAFNIIKVTLIGLGIVKDDGVINSMTRNGDRRELLKGPLYYACA
ITLATVIFWRTSPISIAVICNLCAGDGVADIAGRRFGHVKLPYNPDKSYAGSIAMFLAGF
LASILYMCYFHLFGFVEESWSMVIAFGVTSLAAAIVESLPISTRLDDNLTVPLASVLVGV
LVFYYTGARNLCCMSADSSDISALVQNQMVLDRF
NT seq 825 nt   +upstreamnt  +downstreamnt
atgtggattctggagagcccgctgctccgggacgccggcgccgccgtgctcaccggagcc
accgccctcgccgtgcttcgtttctgggaagaggtcggcaaccgcgccctcttggaccag
aaactctgcaggaaactcgtgcatattactgttggcttagtatacttccttatgtggcct
ttgttcagtgcggatgatgtctatgctccatttcttgcttcccttgtcattgcattcaac
atcataaaggttaccttgattggacttggtattgtcaaagatgatggcgtcattaactcc
atgaccaggaacggagaccgcagagagcttcttaaaggtccactgtactacgcttgtgct
ataacactcgctactgtaattttctggaggacatctcccatttcaatcgcagtgatttgc
aacttgtgtgccggagatggtgtagctgacatagctggaaggcgattcggacatgtaaag
cttccttacaaccctgataagtcttatgctggatccattgcaatgttcttagctggtttc
cttgcatcaatcctgtacatgtgctacttccacctctttggatttgtcgaggagagctgg
agcatggtgatcgcctttggtgtgacatcgcttgctgctgcaattgtggagtcactccct
atcagcacacgcctggacgacaatctgactgtgccactcgcctctgtcctcgttggtgtc
cttgttttctattatactggggccagaaacctgtgttgtatgagcgctgacagcagtgac
atttctgcacttgtgcagaatcagatggtcttggacaggttctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351259
Entry
4351259           CDS       T01015                                 
Name
(RefSeq) probable phytol kinase 2, chloroplastic
  KO
K15892  farnesol kinase [EC:2.7.1.216]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00900  Terpenoid backbone biosynthesis
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    4351259
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.216  farnesol kinase
     4351259
SSDB
Other DBs
NCBI-GeneID: 4351259
NCBI-ProteinID: XP_015618811
UniProt: Q2QYV3 A0A8J8Y532
LinkDB
Position
12:complement(289714..291588)
AA seq 271 aa
MESQVLRDAGAAVLTGATALAVLRFWEEVGNRALLDQKLCRKLVHITVGLVYFLMWPLFS
ADDVYAPFLASIVIAFNIIKVTLIGLGIVKDDGVINSMTRNGDPRELLKGPLYYACAMTL
ATVIFWRTSPISIAVICNLCAGDGVADIAGRQLGRIKLPYNPDKSYAGSIAMFLAGFLAS
ILYMCYFHLFGFVEESWTMVIAFGVTSLSAAIVESLPISTRLDDNLTVPLASVLIGVLVF
YYIGARNLCCMSADSSDISALVQNQMFLGRF
NT seq 816 nt   +upstreamnt  +downstreamnt
atggagagtcaggtgctccgggacgccggcgccgccgtgctcaccggagccaccgcgctc
gccgtgcttcgcttctgggaagaggtcggcaaccgcgccctcttggaccagaaactttgc
aggaaactcgtgcacattactgttggcttagtatacttcctcatgtggcctttgttcagt
gcggatgatgtctatgctccatttcttgcttccattgtcattgcattcaacatcataaag
gttaccttgattggacttggtattgtcaaagatgatggtgtcattaactccatgaccagg
aacggagaccctagagagcttcttaaaggaccactgtactacgcttgtgctatgactctc
gctactgttattttctggaggacatctcccatttcaatcgctgtgatttgcaacttgtgt
gccggagacggtgtagctgacatagctggaaggcagttaggccgtataaagcttccttac
aaccctgacaaatcttacgctggatccattgcaatgttcttagctggtttccttgcatca
atcctgtacatgtgctacttccacctcttcggatttgtcgaggagagctggaccatggtg
attgcctttggcgtgacatcgctttctgctgcaattgtggagtcgctccctatcagcaca
cgcttggacgacaatctgactgtgccactcgcctctgtcctcattggtgtccttgttttc
tattatattggggccagaaacctgtgctgcatgagcgctgacagcagcgatatttctgca
cttgttcagaatcagatgttcttgggcaggttctag

DBGET integrated database retrieval system