KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327472
Entry
4327472           CDS       T01015                                 
Name
(RefSeq) probable mannose-1-phosphate guanylyltransferase 2
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00051  Fructose and mannose metabolism
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
osa01250  Biosynthesis of nucleotide sugars
Module
osa_M00114  Ascorbate biosynthesis, plants, fructose-6P => ascorbate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    4327472
   00520 Amino sugar and nucleotide sugar metabolism
    4327472
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     4327472
SSDB
Motif
Pfam: NTP_transferase Hexapep NTP_transf_3 DUF4954 CTP_transf_3
Other DBs
NCBI-GeneID: 4327472
NCBI-ProteinID: XP_015622139
UniProt: Q941T9
LinkDB
Position
1:36395491..36398110
AA seq 361 aa
MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKEVGVTEVVLAINYRPEVM
LNFLKDFEDKLGITITCSQETEPLGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPFAE
LIKFHKSHGGEATIMVTKVDEPSKYGVVVMEEVTGMVEKFVEKPKIFVGNKINAGIYLLN
PSVLDRIELKPTSIEKEVFPRIASDAKLFALVLPGFWMDVGQPRDYITGLRLYLDSLRKR
STNRLATGAHIVGNVLVHESAKIGEGCLIGPDVAIGPGCVVEDGVRLSRCTVMRGVHIKK
HACISNSIIGWHSTVGQWARIENMTILGEDVHVGDEVYTNGGVVLPHKEIKSSILKPEIV
M
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgaaggcgctcattcttgttggaggcttcggcactcgccttcggcctttgacgctcagt
ttcccaaagcctcttgttgatttcgcgaacaagcccatgattctgcatcagattgaggcc
ttgaaagaagttggagtaacagaagttgttttagccatcaactaccgaccggaggtaatg
ctcaatttcctgaaggactttgaggataagcttggcatcacaatcacgtgttcccaagag
actgagcccttgggaactgctggccctcttgctctagcaagggacaagcttgtggatgga
tctggtgagccattctttgtcctcaacagtgacgtcataagtgaatacccttttgctgag
ctcataaaatttcacaagagccatggtggtgaggcaacgattatggtcaccaaggtggac
gaaccatcaaaatatggtgttgtggttatggaggaggtcactggaatggtggaaaaattt
gttgagaaaccaaaaatatttgtaggcaacaagatcaatgcgggaatttacttgttgaat
ccatctgtcctggaccgcatcgagctgaagccaacttcaattgagaaagaggtctttcct
cgaattgcatctgatgcaaagctctttgctctggtccttccaggtttttggatggatgtt
ggccaaccaagggattacattacaggcttgcgcctttatctggattcacttaggaagaga
tcaaccaacaggttagccactggagcacacattgttgggaatgtgctagttcacgagagt
gccaagattggcgaaggctgtctgattggtcctgatgttgctatcggtcctggatgcgtc
gtggaggatggtgtgaggctttcccgttgcacggtgatgcgtggcgtgcacattaagaag
catgcttgcatatcaaacagcattattggatggcactcaactgttggacaatgggcacgg
atagaaaatatgactatcctgggagaggacgtacatgtaggtgatgaggtctataccaac
ggcggtgttgttctcccgcacaaagagatcaagtcaagcatcctgaagcctgagattgtc
atgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332014
Entry
4332014           CDS       T01015                                 
Name
(RefSeq) mannose-1-phosphate guanyltransferase alpha
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00051  Fructose and mannose metabolism
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
osa01250  Biosynthesis of nucleotide sugars
Module
osa_M00114  Ascorbate biosynthesis, plants, fructose-6P => ascorbate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    4332014
   00520 Amino sugar and nucleotide sugar metabolism
    4332014
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     4332014
SSDB
Motif
Pfam: NTP_transferase Hexapep NTP_transf_3 Fucokinase CTP_transf_3
Other DBs
NCBI-GeneID: 4332014
NCBI-ProteinID: XP_015632386
UniProt: Q10Q61 A0A8J8YPL9
LinkDB
Position
3:complement(5680672..5685422)
AA seq 415 aa
MAASEQRVVAVIMVGGPTKGTRFRPLSLNVPKPLFPLAGQPMVHHPISACRRIPNLAQIY
LVGFYEEREFALYVSSISNELRVPVRYLREDKPHGSAGGLYSFRDYIMEDSPSHIVLLNC
DVCSSFPLPDMLEAHKKYGGMGTLLVNKVSAESANQFGELVADPETNELLHYTEKPETFV
SDLINCGVYIFTPNIFNAIEDVLKQKKDRANLRRVSSFEALHSATKALPADYVRLDQDIL
SPLAGKKELYTYQTLDFWEQIKTPGMSLRCSGLYLSQFRHTSPHLLASGDGKRSATIIGD
VYIHPSAKVHPTAKIGPNVSISANARIGAGARLIHCIILDDVEIMENAVVIHSIVGWKST
VGKWSRVQGEGDHNAKLGITILGEAVDVEDEVVVVNSIVLPNKTLNVSVQEEIIL
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggctgcctccgagcagcgcgtcgtcgccgtcatcatggtcggcgggccgaccaaaggg
acgaggttccggccgctgtcgctgaacgtgccgaagccgctgttcccgctcgccggccag
cccatggtgcaccacccaatctccgcctgccgccgcatccccaacctggcgcagatatac
ctcgtcgggttctacgaggagcgggagttcgcgctctacgtctcctcgatctccaacgag
ctcagggtccccgtcaggtacctgagggaggataagccccatggatcagctggagggctc
tacagcttcagggattacatcatggaggacagtccgtcgcacattgttttgttgaactgt
gatgtatgctcgagcttccccctgccagacatgctcgaggcccacaaaaagtatggtgga
atgggtactttattagtcaataaggtctccgcagagtctgcaaaccaatttggtgagctc
gtagctgaccctgaaacaaatgaactgttacactacacagaaaagccagagacttttgtg
agtgatctcataaattgtggggtctatatatttacacccaatatctttaatgccatcgag
gatgtcttaaaacagaagaaagacagagctaacctgcgccgtgtctctagttttgaagct
cttcactcggcaacaaaagcacttccagcagactatgttaggttagatcaagatatttta
tcccctctagcaggaaagaaggaactttacacataccagactctcgacttttgggaacag
atcaagaccccagggatgtctttgagatgctctggcctatatctttctcagttccgccat
acctctcctcatcttttagcctcaggagatggcaaaaggagtgccactattataggtgat
gtgtacattcatccgtctgcaaaggttcatccaacagcaaagatcggtcctaatgtctcg
atatcagcaaatgcacgtattggagctggagccaggcttattcattgcattattctggat
gatgttgaaattatggagaatgcagttgttatacactcaattgtggggtggaagtcaacc
gtaggaaaatggtcacgtgtacagggtgaaggtgaccataacgccaaactcggtatcaca
attcttggtgaagccgttgatgttgaagatgaagtggttgtagttaacagcattgtgctc
cccaataaaactctcaatgtcagtgtgcaagaggagatcatattatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332373
Entry
4332373           CDS       T01015                                 
Name
(RefSeq) probable mannose-1-phosphate guanylyltransferase 1
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00051  Fructose and mannose metabolism
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
osa01250  Biosynthesis of nucleotide sugars
Module
osa_M00114  Ascorbate biosynthesis, plants, fructose-6P => ascorbate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    4332373
   00520 Amino sugar and nucleotide sugar metabolism
    4332373
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     4332373
SSDB
Motif
Pfam: NTP_transferase NTP_transf_3 Hexapep CTP_transf_3 Hexapep_2 IspD DUF4954
Other DBs
NCBI-GeneID: 4332373
NCBI-ProteinID: XP_015632712
UniProt: Q84JH5
LinkDB
Position
3:complement(8909152..8912953)
AA seq 361 aa
MKALILVGGFGTRLRPLTLSVPKPLVDFGNKPMILHQIEALKEVGVTEVVLAINYQPEVM
LNFLKDFESKLGIKITCSQETEPLGTAGPLALARDKLADGSGDPFFVLNSDVISEYPFAE
LIQFHKSHGGEATIMVTKVDEPSKYGVVVMEDETDKVERFVEKPKVFVGNKINAGIYLLN
PSVLDRIELKPTSIEKEVFPRIAADNGLFAMVLPGFWMDIGQPRDYITGLRLYLDSLRKK
APAKLASGAHVLGNVLVHETAVIGEGCLIGPDVAVGPGCVVEAGVRLSRCTVMRGARVKK
HACISSSIIGWHSTVGMWARVENMTILGEDVHVCDEVYSNGGVVLPHKEIKSSILKPEIV
M
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgaaggcgctcattctcgtgggaggcttcggcactcgcctgcggccgctgactctcagc
gtgccaaagccgctcgtcgatttcgggaacaagcccatgatcctgcatcagatcgaagct
ctgaaagaagttggagttacagaagttgttctggccatcaattaccagcccgaggtcatg
cttaactttctcaaggacttcgagagcaagcttggtatcaagatcacctgctcgcaggag
acagagccactcggaaccgccgggccgctggccctggcacgcgacaagctcgctgacggc
tccggcgaccctttcttcgtcctcaacagcgacgtgatcagcgagtacccattcgccgag
ctcatccagttccacaagtcccatggcggcgaggccacgatcatggtcaccaaggttgac
gagccttccaagtacggcgtggtggtcatggaggatgagaccgacaaggtggagcgcttc
gtggagaagcccaaggtgttcgtcggcaacaagatcaacgccggcatctacctgctcaac
ccgtcggtgctggaccgcatcgagctgaagcccacgtccatcgagaaggaggtgttcccg
cgcatcgccgcggacaatggcctgttcgccatggtcctgcctgggttctggatggacatc
gggcagccgagggactacatcaccgggctgaggctgtacctcgactcgcttaggaagaag
gcgcccgccaagctcgcgtcgggcgcgcacgtcctgggcaacgtgctcgtccacgagacc
gccgtcatcggcgagggttgcctgatcgggccggacgtcgccgttggccccgggtgcgtg
gtggaggccggggtgaggctgtcccggtgcacggtgatgcgcggcgcccgcgtcaagaag
cacgcgtgcatctccagcagcatcatcgggtggcactccaccgtcggcatgtgggcgcgc
gtcgagaacatgaccatcctcggcgaggacgtgcacgtctgcgacgaggtctacagcaac
ggcggcgtggtgctcccgcacaaggagatcaagtccagcatcctcaagcccgagattgtc
atgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345021
Entry
4345021           CDS       T01015                                 
Name
(RefSeq) probable mannose-1-phosphate guanylyltransferase 3
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00051  Fructose and mannose metabolism
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
osa01250  Biosynthesis of nucleotide sugars
Module
osa_M00114  Ascorbate biosynthesis, plants, fructose-6P => ascorbate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    4345021
   00520 Amino sugar and nucleotide sugar metabolism
    4345021
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     4345021
SSDB
Motif
Pfam: NTP_transferase Hexapep NTP_transf_3 DUF4954 CTP_transf_3
Other DBs
NCBI-GeneID: 4345021
NCBI-ProteinID: XP_015650623
UniProt: Q6Z9A3
LinkDB
Position
8:complement(8342236..8346662)
AA seq 361 aa
MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKEVGVTEVVLAINYRPEVM
LNFLKDFEDKLGITITCSQETEPLGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPFAE
LIKFHKNHGGEATIMVTKVDEPSKYGVVVMEEATGMVEKFVEKPKIFVGNKINAGIYLLN
PSVLDRIELKPTSIEKEVFPRISADAKLFAMVLPGFWMDVGQPRDYITGLRLYLDSLRKR
SANRLATGAHIVGNVLVHESAKIGEGCLIGPDVAIGPGCVVEDGVRLSRCTVMRGVRIKK
HACISNSIIGWHSTVGQWARIENMTILGEDVHVGDEVYTNGGVILPHKEIKSSILKPEIV
M
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgaaggcgctcattctggttggaggcttcggcactcgccttcggcctttaacgctcagt
ttcccaaagcctcttgttgatttcgcgaacaagcccatgattctgcatcagattgaggcc
ttgaaagaagttggagtaacagaagttgttttagccatcaactaccgcccggaggtaatg
ctcaatttcctgaaggactttgaggataagcttggcatcacaatcacgtgttcccaagag
actgagcccttgggaactgctggccctcttgctctagcaagggacaagcttgtggatgga
tctggtgagccattctttgtcctcaacagtgacgtcataagtgaatacccttttgctgag
ctcataaaatttcacaagaaccatggtggtgaggcaacaattatggtcaccaaggtggac
gaaccatcaaaatatggtgttgtggttatggaggaggccactggaatggtggaaaaattt
gttgagaaaccaaaaatatttgtaggcaacaagatcaatgcaggaatttacttgttgaac
ccgtctgtcctggaccgcatcgagctaaagccaacttcaattgagaaagaggtctttcct
cgaatctcagctgatgcaaagctctttgctatggtccttccaggtttttggatggatgtt
ggccaaccaagggattacattacaggcttgcgcctttatctggattcacttaggaagaga
tcagccaacaggttagccactggagcacacattgttgggaatgtgctagttcacgagagt
gcgaagattggcgaaggctgtctgattggtcctgatgttgctattggtcctggatgcgtc
gtggaggatggtgtgaggctttcccgttgcacggtgatgcgtggcgtgcgtattaagaag
catgcttgcatatcaaacagcattattggatggcactcaactgttggacaatgggcacgg
atagaaaatatgactatcctaggagaggacgtacatgtaggtgatgaggtctataccaac
ggcggtgttattctcccgcacaaagagatcaaatcaagcatcctgaaacctgagattgtc
atgtga

DBGET integrated database retrieval system