KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327475
Entry
4327475           CDS       T01015                                 
Name
(RefSeq) aldo-keto reductase family 4 member C10 isoform X1
  KO
K00002  alcohol dehydrogenase (NADP+) [EC:1.1.1.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00040  Pentose and glucuronate interconversions
osa00053  Ascorbate and aldarate metabolism
osa00561  Glycerolipid metabolism
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4327475
   00040 Pentose and glucuronate interconversions
    4327475
   00053 Ascorbate and aldarate metabolism
    4327475
   00620 Pyruvate metabolism
    4327475
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4327475
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4327475
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.2  alcohol dehydrogenase (NADP+)
     4327475
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4327475
SSDB
Motif
Pfam: Aldo_ket_red DUF1648
Other DBs
NCBI-GeneID: 4327475
NCBI-ProteinID: XP_015630635
UniProt: Q941T8
LinkDB
Position
1:36403403..36407380
AA seq 311 aa
MAKHFVLNTGAKIPSVGLGTWQSDPGVVGDAVYAAVKAGYRHIDCARMYKNENEVGIALK
KLFEEGVVKREDLFITSKLWCDCHAPEDVPESLDKTLSDLQLEYLDLYLIHWPFRVKKGS
GISNTEDYIPPDIPSTWGAMEKLYDSGKSRAIGVSNFSSKKLGDLLAVACVPPAVDQVEC
HPGWQQTKLHNFCQSTGVHLSAYSPLGSPGSTWMNSNVLKESVIISIAEKLGKTPAQVAL
HWNIQMGHSVLPKSVTEERIKQNIDVYDWSIPEDLLVKFSEIKQVRLLRGDVIVNPHSVY
KTHEELWDGEI
NT seq 936 nt   +upstreamnt  +downstreamnt
atggcgaagcatttcgtgctcaacaccggcgccaagatcccctcggtggggctcggcacc
tggcagtccgacccgggcgtcgtcggcgacgccgtctacgccgctgtcaaggcggggtac
cggcacatcgattgcgccagaatgtacaaaaatgaaaatgaggtggggatagctctgaag
aagctatttgaagaaggtgttgtcaagcgtgaagatttatttatcacatctaagctatgg
tgtgattgtcatgccccagaggatgtgcctgagtcactagacaaaactctgagtgactta
cagcttgagtacctggatctttaccttattcattggccattcagagtcaagaagggctca
ggcattagtaacactgaagactacataccacctgacatcccatctacctggggagcaatg
gagaagctatatgattctggtaaatctcgtgccattggtgtaagtaacttctcatcaaaa
aaactgggtgacctgcttgctgtagcctgtgtacctccagctgttgatcaggtagaatgc
catcctggttggcagcaaacgaagctacataacttctgccagtcaactggcgttcatctt
tctgcatactcgcctctaggttcacctggttcaacatggatgaacagtaacgtccttaag
gaatccgtcatcatctcaattgcagagaagctcggcaaaactcctgcacaagtggcactg
cactggaacattcagatgggtcacagtgtactcccaaaaagtgtgaccgaagaaaggata
aagcagaacatagatgtttatgactggtctattccagaggacttgcttgttaagttctct
gagattaagcaggttaggcttctcaggggcgacgtcattgttaatccccacagcgtttat
aagacccatgaggagctctgggacggcgaaatttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327476
Entry
4327476           CDS       T01015                                 
Name
(RefSeq) aldo-keto reductase family 4 member C10
  KO
K00002  alcohol dehydrogenase (NADP+) [EC:1.1.1.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00040  Pentose and glucuronate interconversions
osa00053  Ascorbate and aldarate metabolism
osa00561  Glycerolipid metabolism
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4327476
   00040 Pentose and glucuronate interconversions
    4327476
   00053 Ascorbate and aldarate metabolism
    4327476
   00620 Pyruvate metabolism
    4327476
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4327476
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4327476
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.2  alcohol dehydrogenase (NADP+)
     4327476
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4327476
SSDB
Motif
Pfam: Aldo_ket_red BLACT_WH
Other DBs
NCBI-GeneID: 4327476
NCBI-ProteinID: XP_015642737
UniProt: Q941T6 A0A8J8XE40
LinkDB
Position
1:36410644..36414610
AA seq 311 aa
MAKHFVLNTGAKIPSVGLGTWQSDPGVVGNAVYAAVKAGYRHIDCASAYNNEKEVGLALK
KLFEEGVVKREDLFITSKLWCDHHAPEDVPEALDATLNDLQLEYLDLYLIHWPFRTKKGS
SIGKPESYLPPDIPSTWAAMEKLYDSGKSRAIGVSNFSSKKLGDLLAAARVPPAVDQVEC
HPGWQQMKLHNFCQSTGIHLSAYSPLGSPGSTFMNGNVLKEPIIISIAEKLGKTPAQVAL
RWNIQMGHSVLPKSVSEERIKQNLDVYDWSIPEDLLAKFSEIKQVRLLRGNFIVNPQSVY
KTHEELWDREI
NT seq 936 nt   +upstreamnt  +downstreamnt
atggcgaagcacttcgtgctcaacaccggcgccaagatcccctccgtgggcctcggcacc
tggcagtccgaccccggcgtcgtcggcaacgccgtctacgccgccgtcaaggcggggtat
cggcacatcgattgcgccagtgcgtacaacaacgaaaaggaggtagggttggctctgaag
aagctatttgaagagggtgtggtcaaacgcgaagatctgtttatcacgtctaagctatgg
tgtgatcatcatgccccagaggatgtgcctgaggcactagatgctaccttgaatgactta
cagcttgagtacctggatctttacctcattcattggccattcagaaccaagaagggatcc
agcattggcaaacctgaaagctacttaccacctgacatcccatctacctgggcagcaatg
gagaagttatatgattctggcaaaagtcgtgccattggtgtgagtaacttctcatcgaaa
aaattgggtgacctgcttgctgcagcccgtgtacctccagctgttgaccaggtggagtgc
catcctggttggcagcagatgaagctgcataacttttgccagtcaacgggcattcatctt
tctgcatactcgccgctaggttcacctggttcaacatttatgaacggcaatgtccttaag
gaacccatcattatctcgattgcagagaagcttggcaaaactcctgcacaagtggcgctg
cgctggaacattcagatgggtcacagtgtactcccaaaaagtgtgagtgaagaaaggata
aagcagaacttagatgtttatgactggtctattccagaggacttgcttgctaagttctcg
gagattaagcaggttaggctgctcaggggcaacttcattgtcaatccacagagcgtttac
aagacccatgaggagctctgggacagggaaatttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338986
Entry
4338986           CDS       T01015                                 
Name
(RefSeq) aldo-keto reductase family 4 member C9
  KO
K00002  alcohol dehydrogenase (NADP+) [EC:1.1.1.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00040  Pentose and glucuronate interconversions
osa00053  Ascorbate and aldarate metabolism
osa00561  Glycerolipid metabolism
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4338986
   00040 Pentose and glucuronate interconversions
    4338986
   00053 Ascorbate and aldarate metabolism
    4338986
   00620 Pyruvate metabolism
    4338986
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4338986
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4338986
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.2  alcohol dehydrogenase (NADP+)
     4338986
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4338986
SSDB
Motif
Pfam: Aldo_ket_red
Other DBs
NCBI-GeneID: 4338986
NCBI-ProteinID: XP_015640123
LinkDB
Position
5
AA seq 311 aa
MAESFVLNTNAAIPSVGLGTWQISPGAVQDAIRAAVQVGYRHIDCSPQYGNQKEVGLALK
KLFDEGAVKREDLFITSKLWCTHHAPEDVPEAINTTLKDLQLYYLDLYLVHGPVRAKKGT
KLSVENYLKPDIPATWQAMEKLYDSGKARAIGVSNFSCKKLEDLLNVARVPPAVNQVECH
PVWQQGKLRKLCQSKGVHLSAYAPLGSPGSPGNDGPNVLSHPTVISIAKKLQKSPAQVAL
RWGIQMGQSVLPKSDNEVWTRENIDIFDWCIPEELMAKFYEIQQVRLFKYEFLTHPTSFY
KSLEDFWDGEI
NT seq 936 nt   +upstreamnt  +downstreamnt
atggctgaatcctttgtcctaaacaccaacgcggcgatcccatcagtcggtcttggcacc
tggcaaatttcaccaggtgctgttcaagatgccatccgcgctgctgtccaggttggatat
cgtcatattgactgttctccacagtatggtaatcagaaagaggttggtttggcactgaag
aaattatttgacgaaggtgcggttaagcgtgaagatttattcatcacatctaaactgtgg
tgcacacaccatgctccagaagatgtgccagaggcgattaataccacattaaaggatctg
cagctttactacttagatttgtacctagtccacggtccagttcgtgccaagaaaggtact
aaattgagtgtggaaaattacctcaagcctgatatcccagctacatggcaagcaatggag
aagttgtatgattcaggcaaagctcgtgccattggcgtgagcaatttttcatgcaagaag
ctggaggacttgctcaatgttgctcgcgtgcctccagcggtcaaccaggtggagtgccat
ccggtttggcagcaaggcaagctccggaagctctgccaatccaagggcgttcatctttct
gcatatgcaccattaggttcacccggatcaccagggaacgatggaccaaacgttctgagc
catcctactgtgatttccattgccaagaagctgcagaaaagtcctgctcaggttgctctt
cgctggggtattcagatgggacagagcgtgctcccaaagagcgacaatgaggtgtggaca
agggagaacattgacatatttgactggtgcatccctgaagaactgatggcaaagttctac
gagattcaacaggttaggcttttcaagtacgaattcttgacccatccgacgagcttttac
aagtcgctggaggatttctgggacggggagatctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338987
Entry
4338987           CDS       T01015                                 
Name
(RefSeq) aldo-keto reductase family 4 member C10 isoform X1
  KO
K00002  alcohol dehydrogenase (NADP+) [EC:1.1.1.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00040  Pentose and glucuronate interconversions
osa00053  Ascorbate and aldarate metabolism
osa00561  Glycerolipid metabolism
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4338987
   00040 Pentose and glucuronate interconversions
    4338987
   00053 Ascorbate and aldarate metabolism
    4338987
   00620 Pyruvate metabolism
    4338987
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4338987
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4338987
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.2  alcohol dehydrogenase (NADP+)
     4338987
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4338987
SSDB
Motif
Pfam: Aldo_ket_red
Other DBs
NCBI-GeneID: 4338987
NCBI-ProteinID: XP_015640120
LinkDB
Position
5:complement(22410040..22413416)
AA seq 334 aa
MAGRAGRRRQCRLRRRQGDVALSEFRDKLIFHVSFVLSEFSRRLIFHVLLCCLNCMLLQA
GYRHIDCAQAYFNEKEIGVALKKVFDEGIVKREDIFITSKLWCTNHAPEDVPVALDSTLQ
DLQTDYVDLYLIHWPVRMKKGAGFGGQNVLPTDIPATWAAMEKLHDSGKARAIGVSNFSS
KKLEDLLAVARVPPAVDQVECHPVWQQTKLRKFCTSKGIHLSAYSPLGSPGTASVKAVGN
VLAHPVVVSTAEKLGKTPAQVALRWGIQMGHSVLPKSTHEERIKENIDVYDWSIPEDLFI
KLSEIEQMKLIRGEFWTHPEGVYKSIEELWDGEI
NT seq 1005 nt   +upstreamnt  +downstreamnt
atggcaggccgagccgggcgtcgtcggcaatgccgtctacgccgccgtcaaggtgatgtt
gcgttgtctgaatttcgtgacaagttaatttttcatgtgtcttttgtgctgtctgaattt
tcacgcaggttaatttttcatgttcttttgtgctgtctgaattgtatgcttctacaggct
ggttatcggcacatcgattgtgctcaagcctacttcaacgaaaaggagattggggtcgct
ctcaagaaagtgttcgacgagggcatagtcaagcgcgaagatatattcatcacctccaaa
ctctggtgcactaaccatgctccggaggatgtcccggttgcactggacagcacgcttcag
gatttgcagaccgactatgtggatctttaccttatccactggccagtgaggatgaagaag
ggcgccggctttggcgggcaaaacgtcctcccgaccgatatcccggcgacgtgggcggcg
atggagaagctccacgactccggcaaggctcgcgccatcggcgtcagcaacttctcgagc
aagaagctggaggacctgctcgccgtcgcacgcgtgccgccggccgtcgaccaggtggag
tgccacccggtgtggcagcagaccaagctccgcaagttctgcacctccaaaggaatccac
ctctcagcgtactcgccgttgggctcgccggggacagcgtcggtgaaagcggtgggcaat
gtgctcgcgcacccggtggtcgtctccacggcggagaagctggggaagacgccggcgcag
gtggctctacggtgggggattcagatggggcacagcgtgctcccgaagagcacccacgag
gagaggatcaaggagaacattgacgtctatgactggtccatcccggaggacctgttcatc
aagctctctgaaatcgagcagatgaagctgatccgtggagaattctggactcacccggaa
ggcgtctacaaatcaatcgaagagctttgggatggcgaaatctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339090
Entry
4339090           CDS       T01015                                 
Name
(RefSeq) aldose reductase
  KO
K00002  alcohol dehydrogenase (NADP+) [EC:1.1.1.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00040  Pentose and glucuronate interconversions
osa00053  Ascorbate and aldarate metabolism
osa00561  Glycerolipid metabolism
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4339090
   00040 Pentose and glucuronate interconversions
    4339090
   00053 Ascorbate and aldarate metabolism
    4339090
   00620 Pyruvate metabolism
    4339090
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4339090
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4339090
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.2  alcohol dehydrogenase (NADP+)
     4339090
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4339090
SSDB
Motif
Pfam: Aldo_ket_red
Other DBs
NCBI-GeneID: 4339090
NCBI-ProteinID: XP_015639340
UniProt: Q0DHD3 Q65WW3
LinkDB
Position
5:23297054..23300468
AA seq 318 aa
MASAKAMAQDEHHFVLKSGHAIPAVGLGTWRAGSDTAHSVQTAITEAGYRHVDTAAQYGI
EQEVGKGLKAAMEAGINRKDLFVTSKIWCTNLAPERVRPALKNTLKDLQLDYIDLYLIHW
PFRLKDGAHQPPEAGEVLEFDMEAVWREMERLVTDGLVKDIGVCNFSVTKLNRLLQSANI
PPAVCQMEMHPGWKNNKIFEACKKHGIHVTAYSPLGSSEKNLAHDPVVEKIANKLNKTPG
QVLIKWALQRGTSVIPKSTKDERIKENMQVFGWEIPEEDFQVLCGIKDEKRVLTGEELFV
NKTHGPYKSASEVWDNED
NT seq 957 nt   +upstreamnt  +downstreamnt
atggcgagtgccaaggcgatggcgcaggatgagcatcactttgttctgaagagtggtcat
gccatccctgcagttgggttaggcacttggagggccggctcagatactgctcactccgtt
cagacagccatcactgaggctggatacaggcatgtagatacggctgctcaatatggaata
gaacaggaggtcggcaaagggcttaaagctgcgatggaagctggaatcaacaggaaagat
ttgtttgtgacgtcaaaaatatggtgcacaaacttggctcctgagagagttcgaccagca
ttaaagaacacgctgaaggatctccagttggattatatcgacctttaccttattcattgg
cccttccgtctaaaagatggagcacaccagcctcctgaggctggggaagtcttggagttt
gacatggaggcagtatggagggaaatggagagacttgtgacagatggactggttaaggac
attggtgtctgcaatttctcagttaccaagctcaacagactgttgcaatcagctaatatt
ccacctgcagtatgccagatggaaatgcaccctggttggaagaacaataagattttcgag
gcctgcaaaaaacatggaattcatgttactgcctactccccactgggttcttctgaaaag
aaccttgcgcatgatccagttgtcgagaagatagccaacaagctgaacaagactccaggt
caagtgctcatcaagtgggctctccaaaggggaacaagcgttattccaaaatcaactaaa
gatgaaaggattaaggagaatatgcaggtgtttggatgggagatccctgaagaggacttc
caggtcttgtgcggcatcaaagatgagaagcgagtcctgacaggagaggagctcttcgtg
aacaagacccatgggccatacaagagtgcatctgaggtctgggataacgaggactaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9271397
Entry
9271397           CDS       T01015                                 
Name
(RefSeq) aldo-keto reductase family 4 member C10
  KO
K00002  alcohol dehydrogenase (NADP+) [EC:1.1.1.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00040  Pentose and glucuronate interconversions
osa00053  Ascorbate and aldarate metabolism
osa00561  Glycerolipid metabolism
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    9271397
   00040 Pentose and glucuronate interconversions
    9271397
   00053 Ascorbate and aldarate metabolism
    9271397
   00620 Pyruvate metabolism
    9271397
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    9271397
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    9271397
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.2  alcohol dehydrogenase (NADP+)
     9271397
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   9271397
SSDB
Motif
Pfam: Aldo_ket_red CCDC117
Other DBs
NCBI-GeneID: 9271397
NCBI-ProteinID: XP_015622338
LinkDB
Position
1:36418108..36420054
AA seq 304 aa
MATHFTLNTGARIPSVGLGTYKAGTGVVADVVSAAVKAGYRHIDCAPLYKNEQEIGGALK
KLFDDGVVKREDLFITSKIWCSDLAPEDVPLAMDSTLKDLQLDYVDLYLIHWPFQIKKGT
ELSPENFVKPDIPSTWRAMEQLYDSGKARAIGVSNFSSKKLGDLLCVARVPPAVDQVECH
PGWQQAKLRAFCHTSGVHLSAYAPLGRMKGIAVDSVLPSVAEMLGRTPAQVALRWGLQQG
QSVLPKSVSEARLKENMDLFGWSIPEELCAKLSEIEQVKQIRGDGFAHPESVYKTYEELF
DGEI
NT seq 915 nt   +upstreamnt  +downstreamnt
atggccacccacttcacgctcaacaccggagcacgcatcccctcggtgggcctcggcacc
tacaaggccggcaccggcgtcgtcgccgacgtggtctccgccgccgtcaaggcagggtac
cggcacatagactgcgcgccgctgtacaagaacgagcaggagattggtggtgctctgaag
aagctcttcgatgatggggttgtcaagcgggaagacctcttcatcacctccaagatatgg
tgcagcgacctcgcacctgaagatgtcccactcgcaatggatagtacactgaaagatctg
cagctggattacgttgatctgtatctgattcattggccgtttcagatcaagaaaggcacg
gagctcagtccagagaacttcgtcaagcctgacatacccagcacctggcgagcgatggag
cagctgtacgattcaggcaaagctcgcgcgatcggcgtgagcaatttctcctccaagaag
cttggcgatctgctctgcgtcgcccgcgtccctccggccgttgatcaggtcgagtgccac
ccgggctggcagcaggcgaagctcagagcgttctgccacaccagtggcgttcatctctct
gcgtatgctccattgggcaggatgaagggcatcgccgttgattcggtgttgccatcggta
gccgagatgctaggaagaactccggctcaggttgctctgcgctggggtcttcagcagggt
cagagtgtgcttcccaagagcgtcagtgaggcgaggttgaaggagaacatggatctgttt
ggttggtctattcctgaggaactgtgtgccaagctctctgaaatcgaacaggttaagcaa
atcagaggagatggatttgctcaccccgagagtgtctacaaaacctacgaggagcttttt
gatggagaaatctaa

DBGET integrated database retrieval system