KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327518
Entry
4327518           CDS       T01015                                 
Name
(RefSeq) probable WRKY transcription factor 33
  KO
K13424  WRKY transcription factor 33
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04016  MAPK signaling pathway - plant
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    4327518
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4327518
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:osa03000]
    4327518
Transcription factors [BR:osa03000]
 Eukaryotic type
  Other transcription factors
   WRKY
    4327518
SSDB
Motif
Pfam: WRKY
Other DBs
NCBI-GeneID: 4327518
NCBI-ProteinID: XP_015619871
UniProt: Q6IEQ7
LinkDB
Position
1:35347978..35350643
AA seq 555 aa
MTTSSSGSVETSANSRLGTFSFASASFTDLLGGNAGAGGGGVSRYKAMTPPSLPLSPPPV
SPSSFFNSPIGMNQADFLGSPVLLTSSIFPSPTTGAFASQHFDWRPEVAAAQSADQGGKD
EQRNSYSDFSFQTAPASEEAVRTTTFQPPVPPAPLGDEAYRSQQQQQPWGYQQQPAGMDA
GANAASFGAAPFQATSSEMAPQVQGGGGYSQPQSQRRSSDDGYNWRKYGQKQVKGSENPR
SYYKCTFPNCPTKKKVERSLDGQITEIVYKGTHNHAKPQNTRRNSGSSAAQVLQSGGDMS
EHSFGGMSGTAATPENSSASFGDDEIRVGSPRAGNGGGDEFDDDEPDSKRWRKDGDGEGI
SMAGNRTVREPRVVVQTMSDIDILDDGYRWRKYGQKVVKGNPNPRSYYKCTTAGCPVRKH
VERASHDLRAVITTYEGKHNHDVPAARGSAALYRPAPPAAAATSSHPYLPNQPPPMSYQP
TGPQPYALRPDGFGGQGPFGGVVGGSSFGGFSGFDDARGSYMSQHQQQQRQNDAMHASRA
KEEPGDDMFFQNSLY
NT seq 1668 nt   +upstreamnt  +downstreamnt
atgacaacctcgtcgtccgggagcgtcgagacgtcggccaattcgcggctggggacgttc
tcgttcgccagcgcgagcttcacggacctcctcgggggaaacgcgggagccggcggcgga
ggtgtgtccaggtacaaggccatgaccccgccttcgctgccgctctcgccgccgccggtg
tcgccgtcgtccttcttcaacagcccgatcggcatgaaccaggccgacttcctcggctcg
ccggtgctcctgacctccagtatcttcccgtcgccgacgacgggcgcattcgcgtcgcag
cactttgactggaggccggaggtggcggcggcgcagagcgccgatcaaggcggcaaggac
gagcagaggaattcctactccgacttctcgtttcagacggcgcctgcgagcgaggaggcc
gtgcgaacgacgactttccagccaccggtcccaccggccccactgggggacgaggcatac
agaagtcagcagcagcagcagccatggggctaccagcagcagcctgcaggcatggacgcg
ggtgccaacgcggcgagcttcggtgcggcgccgttccaggcgacctcgtcggagatggcg
ccacaggtgcagggtggcggcgggtacagccagccgcagtcgcagaggcggtcgtcggac
gacggctacaactggcgcaagtacgggcagaagcaggtgaaggggagcgagaacccccgc
agctactacaagtgcaccttcccgaactgcccgaccaagaagaaggtggagcggtcgctc
gacggccagatcaccgagatcgtgtacaagggcacgcacaaccacgccaagccgcagaac
acgcgcaggaactccggctcgtcggcggcgcaggtcctgcagagcggcggcgacatgtcg
gagcattccttcgggggcatgtccggcacagcggcgacgcccgagaactcgtcggcgtcg
ttcggtgacgacgagatcagagttggctcccctcgggccgggaacggcggcggcgacgag
ttcgacgacgacgagccggattccaagagatggaggaaagacggtgacggcgaggggatc
tccatggctggcaaccggacggtgcgggaaccgagggtggtcgtccaaaccatgagcgac
atcgacatcctcgacgacggctaccgctggagaaagtacggccagaaggtggtgaagggc
aacccgaacccaaggagctactacaagtgcaccacggccggttgccccgtgcggaagcac
gtggagcgcgcgtcccacgacctgcgcgccgtgatcaccacctacgaggggaaacacaac
cacgacgtgcccgccgcgcgggggagcgccgcgctctaccgccccgcgccgccggcggcg
gccgccaccagcagccacccgtacctgccgaaccagccgccgcccatgtcctaccagccc
acggggccacagccgtacgcgctgaggcccgacgggttcggcggccagggaccgttcggc
ggcgtggtcggcgggagcagcttcggcggcttctccgggttcgacgacgccaggggctcg
tacatgagccagcaccagcagcagcagaggcagaacgacgcgatgcacgcctcgagagcc
aaggaagagcccggagacgacatgttcttccagaactcgctctactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338474
Entry
4338474           CDS       T01015                                 
Name
(RefSeq) probable WRKY transcription factor 26 isoform X1
  KO
K13424  WRKY transcription factor 33
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04016  MAPK signaling pathway - plant
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    4338474
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4338474
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:osa03000]
    4338474
Transcription factors [BR:osa03000]
 Eukaryotic type
  Other transcription factors
   WRKY
    4338474
SSDB
Motif
Pfam: WRKY
Other DBs
NCBI-GeneID: 4338474
NCBI-ProteinID: XP_015640376
LinkDB
Position
5:16150232..16152748
AA seq 531 aa
MASSTGGLDHGFTFTPPPFITSFTELLSGGGGDLLGAGGEERSPRGFSRGGARVGGGVPK
FKSAQPPSLPLSPPPVSPSSYFAIPPGLSPTELLDSPVLLSSSHILASPTTGAIPAQRYD
WKASADLIASQQDDSRGDFSFHTNSDAMAAQPASFPSFKEQEQQVVESSKNGAAAASSNK
SGGGGNNKLEDGYNWRKYGQKQVKGSENPRSYYKCTYNGCSMKKKVERSLADGRITQIVY
KGAHNHPKPLSTRRNASSCATAAACADDLAAPGAGADQYSAATPENSSVTFGDDEADNAS
HRSEGDEPEAKRWKEDADNEGSSGGMGGGAGGKPVREPRLVVQTLSDIDILDDGFRWRKY
GQKVVKGNPNPRSYYKCTTVGCPVRKHVERASHDTRAVITTYEGKHNHDVPVGRRPAGAL
HPRDAPQPRRPLRRLRRRRRRRRVPAHQGRAAGRPVRRVAPLLVEPSRAELSWAPHPPAR
HVAYFRLAVYVRPYSVRIHARTPCPTRQYTHTYSRTHVVAYIYSIVGGSGS
NT seq 1596 nt   +upstreamnt  +downstreamnt
atggcgtcctcgacgggggggttggaccacgggttcacgttcacgccgccgccgttcatc
acgtcgttcaccgagctgctgtcggggggcggtggggacctgctcggcgccggcggtgag
gagcgctcgccgagggggttctccagaggcggagcgagggtgggcggcggggtgcccaag
ttcaagtccgcgcagccgccgagcctgccgctctcgccgccgccggtgtcgccgtcgtcc
tacttcgccatcccgccggggctcagccccaccgagctgctcgactcccccgtcctcctc
agctcctcccatatcttggcgtccccgaccaccggtgcaatcccggctcagaggtacgac
tggaaggccagcgccgatctcatcgcttctcagcaagatgacagccgcggcgacttctcc
ttccacaccaactccgacgccatggccgcgcaaccggcctctttcccttccttcaaggag
caagagcagcaagtggtcgagtcgagcaagaacggcgccgccgccgcgtcgagcaacaag
agcggcggcggcgggaacaacaagctggaggacgggtacaactggaggaagtacgggcag
aagcaggtgaaggggagcgagaacccgaggagctactacaagtgcacctacaacggctgc
tccatgaagaagaaggtggagcgctcgctcgccgacggccgcatcacccagatcgtctac
aagggcgcacacaaccaccccaagccgctctccacccgccgcaacgcctcctcctgcgcc
accgccgccgcctgcgccgacgacctcgcggcgcccggcgcgggcgcggaccagtactcc
gccgcgacgcccgagaactcctccgtcacgttcggcgacgacgaggccgacaacgcatcg
caccgcagcgagggcgacgagcccgaagccaagcgctggaaggaggatgctgacaacgag
ggcagctccggcggcatgggcggcggcgccggcggcaagccggtgcgcgagccgaggctt
gtggtgcagacgctgagcgacatcgacatcctcgacgacggcttccggtggaggaagtac
ggccagaaggtcgtcaagggcaaccccaacccaaggagctactacaagtgcacgacggtg
ggctgcccggtgcggaagcacgtggagcgggcgtcgcacgacacgcgcgccgtgatcacc
acctacgagggcaagcacaaccacgacgtcccggtcggccgccgcccagcaggggcccta
caccctcgagatgctccccaaccccgccggcctctacggcggctacggcgccggcgccgg
cggcgccgcgttcccgcgcaccaaggacgagcggcgggacgacctgttcgtcgagtcgct
cctctgctagtcgagccgagccgagccgagctgagctgggccccacatccccctgctcgc
cacgtggcgtattttcgcctcgccgtatacgtacggccgtatagcgtacgtatacacgct
cgcacgccctgcccaacacggcaatacacacatacatactctcgtacacacgtagtagca
tacatatacagtatagtaggtggtagtggtagctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339092
Entry
4339092           CDS       T01015                                 
Name
(RefSeq) probable WRKY transcription factor 33
  KO
K13424  WRKY transcription factor 33
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04016  MAPK signaling pathway - plant
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    4339092
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4339092
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:osa03000]
    4339092
Transcription factors [BR:osa03000]
 Eukaryotic type
  Other transcription factors
   WRKY
    4339092
SSDB
Motif
Pfam: WRKY FLYWCH
Other DBs
NCBI-GeneID: 4339092
NCBI-ProteinID: XP_015637836
UniProt: A0A0P0WNP6 Q65WW1
LinkDB
Position
5:complement(23310474..23313465)
AA seq 572 aa
MTAAPGSLPLVNSRPVSLSLAASRSSFSSLLSGGAGSSLNLMTPPSSLPPSSPSSYFGGV
SSSGFLDSPILLTPSLFPSPTTTGALFSWITTATATAAIAPESQVQGGVKDEQQQYSDFT
FLPTASTAPATTMAGATATTSNSFMQDSMLMAPLGGDPYNGEQQQPWSYQEPTMDADTRP
AEFTSSAAAGDVAGNGSYSQVAAPAAAGGFRQQSRRSSDDGYNWRKYGQKQMKGSENPRS
YYKCTFPGCPTKKKVEQSPDGQVTEIVYKGAHSHPKPPQNGRGRGGSGYALHGGAASDAY
SSADALSGTPVATPENSSASFGDDEAVNGVSSSLRVASSVGGGEDLDDDEPDSKRWRRDG
GDGEGVSLVAGNRTVREPRVVVQTMSDIDILDDGYRWRKYGQKVVKGNPNPRSYYKCTTA
GCPVRKHVERASNDLRAVITTYEGKHNHDVPAARGSAAAALYRATPPPQASNAGMMPTTA
QPSSYLQGGGGVLPAGGYGASYGGAPTTTQPANGGGFAALSGRFDDDATGASYSYTSQQQ
QQPNDAVYYASRAKDEPRDDGIMSFFEQPLLF
NT seq 1719 nt   +upstreamnt  +downstreamnt
atgaccgccgcgccggggagcctcccgctggtgaactcgaggcccgtctccctctccttg
gcggcgagcaggtcgtccttctccagcctgctcagtggcggcgccggctcgtcgttgaac
ctcatgacgccgccgtcttctctcccgccgtcgtcgccgtcgtcctacttcggcggcgtc
tcgtcctccgggtttctcgactcgccgatcctcctcacgcccagtttattcccatcgccg
acgacgacgggcgcattgttcagctggattacgacggcgacggcgacggcggcgatagcg
ccggagagccaggtgcaaggaggggtcaaggacgagcagcaacagtactcggacttcacg
ttcctgccgacggcgtccacggcgccggcgacgacgatggccggagccaccgcgacgacg
tccaactccttcatgcaggactccatgctaatggctccattgggaggggacccgtacaat
ggcgagcagcagcagccatggagctaccaagaaccgaccatggacgctgacactaggcca
gcggaattcacctcgtcggcggcggcgggtgacgtggccgggaacggcagctacagccag
gtggcggcgccggcggcggccggcggcttccgtcagcagagccggcggtcgtcggacgac
ggctacaactggcgcaagtacgggcagaagcagatgaaggggagcgagaacccgcgcagc
tactacaagtgcaccttccctggctgcccgaccaagaagaaggtggagcagtcgccggac
ggccaggtcaccgagatcgtctacaagggcgcgcacagccaccccaagccgccgcagaac
ggccgcggccgcggcggctccggctacgcgctgcatggcggcgccgccagcgacgcatac
tcctccgccgacgcgctctccggcacgccggtggcgacgcccgagaactcgtcggcgtcg
ttcggggacgacgaggcggtcaacggcgtcagctcgtcgctgcgggtcgcctctagcgtc
ggcggcggcgaggatctcgacgacgacgagcctgattccaagaggtggaggagagacggc
ggcgacggcgagggcgtctcgctggtggccggcaaccggacggtgcgtgagccgagggtg
gttgtgcagacgatgagcgacatcgacatcctcgacgacggctaccggtggcgcaagtac
gggcagaaggtggtcaagggcaacccaaacccaaggagctactacaagtgcacgacggcc
gggtgccccgtgcggaagcacgtggagcgcgcgtccaacgacctgcgcgcggtgatcacc
acgtacgagggcaagcacaaccacgacgtgcccgcggcgcgcgggagcgccgccgccgcg
ctctaccgcgccacgccgccgccgcaggcgagcaacgccggcatgatgcccaccacggcg
cagccctcgagctacctgcagggcggcggcggcgtccttccggccggcgggtacggcgcg
tcgtacggcggcgcgccgacgacgacgcagcccgcgaacggcggtggcttcgccgccctg
tccggccggttcgacgacgacgcgacgggagcgtcttactcttacacgagccagcagcag
cagcagccgaacgacgcggtgtactacgcgtcgagagccaaggatgagccgagagacgac
ggcatcatgtcgttctttgagcagccgctgctgttttga

DBGET integrated database retrieval system