KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327549
Entry
4327549           CDS       T01015                                 
Name
(RefSeq) DNA-directed RNA polymerases II and IV subunit 5A
  KO
K03013  DNA-directed RNA polymerases I, II, and III subunit RPABC1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    4327549
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4327549
   03400 DNA repair and recombination proteins [BR:osa03400]
    4327549
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     4327549
  RNA polymerase III system
   RNA polymerase III
     4327549
  RNA polymerase I system
   RNA polymerase I
     4327549
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      4327549
SSDB
Motif
Pfam: RNA_pol_Rpb5_C RNA_pol_Rpb5_N Mrr_cat DUF2711
Other DBs
NCBI-GeneID: 4327549
NCBI-ProteinID: XP_015649715
UniProt: Q5VQW7 A0A0P0V9H1
LinkDB
Position
1:complement(34163702..34166768)
AA seq 210 aa
MSAGLVTEEVMVGRLVRIRRTVMQMLRDRGYLVVEHELAMGRRDFLRKYGESFHREDLLI
NKYKKNDPSDQIYVFFPNDDKVGMKHIKKYVEMMKAENVSRAVLVLQQNLTPFARSFLQE
LEPKIHLEIFQEAELLINIKEHVLVPEHQVLNNEEKKTLLERYTLKETQLPRIQITDPIA
RYYGLRRGQVVKIIRPSETAGRYVTYRYVV
NT seq 633 nt   +upstreamnt  +downstreamnt
atgtcggcggggctcgtgacggaggaggtgatggtggggcggctggtgcggatccggcgg
acggtgatgcagatgctgcgggacagagggtacctggtggtggagcacgagctcgccatg
ggccgccgcgacttcctccgcaagtacggcgagtccttccaccgcgaggacctcctcatc
aacaagtacaagaagaacgatccctccgaccagatatacgttttcttccctaacgatgac
aaggtgggaatgaaacacataaagaagtacgtcgagatgatgaaagctgagaacgtctcc
agagcggtattggttcttcaacagaacctcactccatttgcaaggtcatttcttcaagaa
ttagagccaaagatccacttggaaattttccaggaagccgaattgcttataaatatcaag
gaacatgttctcgttcctgaacatcaagtgcttaacaatgaggaaaagaagacattattg
gagcggtacactctaaaggaaactcagcttccaagaatacaaattacggaccctattgca
aggtactatggcctcagacgaggacaggttgtgaagatcatcaggcccagcgagacagcc
ggcagatatgttacatatcgttatgttgtataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349748
Entry
4349748           CDS       T01015                                 
Name
(RefSeq) DNA-directed RNA polymerase V subunit 5A
  KO
K03013  DNA-directed RNA polymerases I, II, and III subunit RPABC1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    4349748
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4349748
   03400 DNA repair and recombination proteins [BR:osa03400]
    4349748
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     4349748
  RNA polymerase III system
   RNA polymerase III
     4349748
  RNA polymerase I system
   RNA polymerase I
     4349748
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      4349748
SSDB
Motif
Pfam: RNA_pol_Rpb5_C RNA_pol_Rpb5_N DnaT
Other DBs
NCBI-GeneID: 4349748
NCBI-ProteinID: XP_015616663
UniProt: A0A0P0XYM3
LinkDB
Position
11:complement(2015411..2018165)
AA seq 336 aa
MSHSSPYQQSFTTIESAESATAATSIETAESTTAARDVSPPPAAAPAARDVSPPAAASAA
RDVSPPPAAARDVSPPSAAHDVSPPAAVSAPPPAVVPAAARDAPPPAVAMAAEMEVDDVD
VHEVPECIASMIDRGSVESHRLFLARRTAMEMLRDRGYSVPEAEIARTLPEFRAWWAEKP
GIERLAFTTTLVSDPSKKVQLVFCPPEPVKIATIREIYLQTKEENLSRLVLILQSKILSR
AREAIKEIFKFKVDIFQATDLLVNITKHVLKPKHEVLSADQKAKLLKEYNVEDSQLPRML
ETDAVARYYGFDKGTVVKVIYDGELTGKRVAYRCVF
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgagtcactcctccccctaccagcaatccttcacgacaatagaatcggctgagagcgcg
accgccgccacctcaatagaaaccgccgagagcaccaccgccgcccgcgacgtttcccct
cctcccgccgccgcccccgccgcccgcgacgtttcccctcccgccgccgcctccgccgca
cgcgacgtttcccctcctcctgccgccgcccgcgacgtttcccctccctccgccgcacac
gacgtttcccctcccgccgctgtctccgcccctcctcctgccgtcgtccccgctgctgcg
cgcgacgctccccctcccgccgtcgccatggcggcggagatggaagtcgacgacgtcgac
gtgcatgaggtccccgaatgcatagcatcgatgatcgaccgcggcagcgtggagagccac
cgcctgttcctggcgcgccggacggcgatggagatgctccgcgaccgcgggtacagcgtg
ccggaggccgagatcgcccgcaccctccctgagttccgcgcctggtgggctgagaagccc
gggatcgaacgcctcgccttcaccaccaccctcgtctccgacccctccaagaaggtacaa
cttgtattctgtccaccagagcctgtcaaaatcgcaactatccgagagatatatctccaa
acaaaagaagagaacttgtccaggcttgttctgatactgcagagcaaaatattatctaga
gctagagaggctatcaaggagatctttaaatttaaagtggacatattccaggccacagat
ttactggtaaacattactaagcatgtcctgaaacccaagcatgaagtgttgagtgcagat
caaaaggccaagctcctcaaggaatacaatgtggaagactcacagttgccacgcatgcta
gagactgatgctgttgctcgctactatggctttgacaagggaaccgtggttaaagttata
tatgacggtgaacttactgggaagcgtgtggcataccgatgcgtcttctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351463
Entry
4351463           CDS       T01015                                 
Name
(RefSeq) DNA-directed RNA polymerase V subunit 5A
  KO
K03013  DNA-directed RNA polymerases I, II, and III subunit RPABC1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    4351463
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4351463
   03400 DNA repair and recombination proteins [BR:osa03400]
    4351463
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     4351463
  RNA polymerase III system
   RNA polymerase III
     4351463
  RNA polymerase I system
   RNA polymerase I
     4351463
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      4351463
SSDB
Motif
Pfam: RNA_pol_Rpb5_C RNA_pol_Rpb5_N DnaT
Other DBs
NCBI-GeneID: 4351463
NCBI-ProteinID: XP_015619629
UniProt: Q2QXY2
LinkDB
Position
12:complement(1917873..1920664)
AA seq 335 aa
MSHSSPSQQSFTTIESAESATAATSIETAESTTAARDVSPPAAVSAARDVSPPPAAARDV
SPPSAAASAARDVSPPSAAAPAAARDVPPPPAVVPAAALDVPPPAVVPMAAEMEVDDVDV
HEVPECIASMIDRGSVESHRLFLARRTAMEMLRDRGYSVPEAEIARTLPEFRAWWAEKPG
IERLAFTTTLVSDPSKKVQLVFCPPEPVKIATIREIYLQTKEENLSRLVLILQSKILSRA
REAIKEIFKFKVDIFQATDLLVNITKHVLKPKHEVLSADQKAKLLKEYNVEDSQLPRMLE
TDAVARYYGFDKGTVVKVTYDGELTGKRVAYRCVF
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgagtcactcctccccctcccagcaatccttcaccacaatagaatcggctgagagcgcg
accgccgccacttcaatagaaaccgccgagagcaccaccgccgcccgcgacgtgtcccct
cccgccgccgtctccgccgcgcgcgacgtttcccctcctcctgccgccgcccgcgacgtt
tcccctccctcagccgccgcctccgccgcccgcgacgtttcccctccctcggccgccgcc
cccgccgctgcgcgcgacgttccccctcctcctgccgtcgtccccgctgctgcgctcgac
gttccccctcccgccgtcgtccccatggcggcggagatggaagtcgacgacgtcgacgtg
catgaggtccccgaatgcatagcgtcgatgatcgaccgcggcagcgtggagagccaccgc
ctgttcctggcgcgccgcacggcaatggagatgctccgcgaccgcgggtacagcgtgccg
gaggccgagatcgcccgcaccctccctgagttccgcgcatggtgggctgagaagcctggg
atcgaacgcctcgccttcaccaccaccctcgtctccgacccctccaagaaggtacaactt
gtattctgtccaccagagcctgtcaaaatcgcaactatccgagagatatatctccaaaca
aaagaagagaacttgtccaggcttgttctgatactgcagagcaaaatattatctagagct
agagaggctatcaaggagatctttaaatttaaagtggacatattccaggccacagattta
ctggtaaacattactaagcatgtcctgaaacccaagcatgaagtgttgagtgcagatcaa
aaggccaagctcctcaaggaatacaatgtggaagactcacagttgccacgcatgctagag
actgatgctgttgctcgctactatggctttgacaagggaaccgtggttaaagttacatat
gacggcgaacttactgggaagcgtgtggcataccgatgcgtcttctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9270850
Entry
9270850           CDS       T01015                                 
Name
(RefSeq) DNA-directed RNA polymerases II and IV subunit 5A
  KO
K03013  DNA-directed RNA polymerases I, II, and III subunit RPABC1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    9270850
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    9270850
   03400 DNA repair and recombination proteins [BR:osa03400]
    9270850
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     9270850
  RNA polymerase III system
   RNA polymerase III
     9270850
  RNA polymerase I system
   RNA polymerase I
     9270850
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      9270850
SSDB
Motif
Pfam: RNA_pol_Rpb5_C RNA_pol_Rpb5_N Mrr_cat
Other DBs
NCBI-GeneID: 9270850
NCBI-ProteinID: XP_015635810
UniProt: Q7XUF8
LinkDB
Position
4:complement(24352460..24355421)
AA seq 205 aa
MASEEETSRLFRIRRTVMQMLRDRGYLVTELDIDLPRGDFVARFGDPVDRDHLVFSRHKK
DNGADQIYVFFPKDAKPGVKTIRSYVERMKQESVFNGILVVQQALSAFARSAVQEVSQKF
HLEVFQEAELLVNIKDHTLVPEHELLTPEQKKTLLERYTVKETQLPRIQITDPIARYYGM
KRGQVVKIIRASETAGRYVTYRYVV
NT seq 618 nt   +upstreamnt  +downstreamnt
atggcgtcggaggaggagacgagccggcttttccgcatccgccgcacggtgatgcagatg
ctgcgggacaggggctacctcgtgacggagttggacatcgacctcccgaggggcgacttc
gtcgcacgcttcggggatcccgtcgaccgcgaccatctcgtcttcagccgccacaagaag
gacaacggcgccgaccagatctacgtcttcttccccaaggacgcgaagcccggggtgaag
acgatcaggagctacgtggagaggatgaagcaggagagcgtgttcaacggcatcctcgtc
gtgcagcaggcgctcagcgcgttcgcccgcagcgccgtgcaggaggtctcccagaagttc
cacctcgaggtcttccaggaagcggaactgcttgtgaacattaaggatcatacccttgtg
ccagagcacgagctcctgacgcctgagcagaagaagacgctgctggagcggtataccgtg
aaagagactcagctcccccggattcaaattacggacccaatagcaagatattacggcatg
aagcgtgggcaagttgtaaagatcatccgtgctagtgagaccgctggaagatatgtgacg
taccgttatgtggtgtga

DBGET integrated database retrieval system