KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327570
Entry
4327570           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S26
  KO
K02976  small subunit ribosomal protein S26e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4327570
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4327570
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4327570
  Archaea
    4327570
SSDB
Motif
Pfam: Ribosomal_S26e
Other DBs
NCBI-GeneID: 4327570
NCBI-ProteinID: XP_015622447
UniProt: P49216
LinkDB
Position
1:35153620..35155820
AA seq 133 aa
MTFKRRNGGRNKHGRGHVKYIRCSNCAKCCPKDKAIKRFQVRNIVEQAAIRDVQEACVHD
GYVLPKLYAKVHHCVSCAIHAHIVRVRSRENRRDRRPPERFRRREDRPQGPRPGGGAPAP
GGAAAPAPNVART
NT seq 402 nt   +upstreamnt  +downstreamnt
atgaccttcaagcgccgcaatggcggccgcaacaagcacggtcgcggccacgtcaagtac
atccgctgctccaactgcgccaagtgctgccccaaggacaaggcgatcaagaggtttcag
gtgaggaacatcgtggagcaggccgccatcagggacgtccaggaggcgtgcgtgcacgat
ggatacgttctccccaagctttacgccaaggtgcatcactgtgtgtcctgtgcaatccat
gctcacatcgtccgtgtccgctcccgtgagaaccggagggaccgcaggcctccggaacgc
ttccgccgcagggaggataggccccaaggccctcgtccaggtggtggcgctcccgctcct
ggtggagctgctgctcctgcccccaacgttgctcgcacctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339104
Entry
4339104           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S26-like
  KO
K02976  small subunit ribosomal protein S26e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4339104
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4339104
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4339104
  Archaea
    4339104
SSDB
Motif
Pfam: Ribosomal_S26e
Other DBs
NCBI-GeneID: 4339104
NCBI-ProteinID: XP_015640325
UniProt: B9FJR5 Q0DHB9
LinkDB
Position
5:complement(23483304..23485851)
AA seq 136 aa
MTFKRRNGGRNKHGRGHVKYIRCSNCAKCCPKDKAIKRFQVRNIVEQAAIRDVQEACVHD
GYVLPKLYAKVHHCVSCAIHAHIVRVRSRENRRDRRPPERFRRREDRPTGPRPGGAGGPG
APAAAGPGGPPNVART
NT seq 411 nt   +upstreamnt  +downstreamnt
atgaccttcaagcgcaggaacggcggccgcaacaagcatggccgcggccatgtgaagtac
atccgctgctccaactgcgccaagtgctgccccaaggacaaggccatcaagaggttccag
gtgaggaacatcgtcgagcaggcggccatcagggatgtccaggaggcgtgcgtccatgac
ggatacgtcctcccgaagctgtacgccaaggtccatcactgcgtctcctgcgccatccac
gcccacatcgtccgtgtccgctcccgcgagaaccgcagggaccgcaggccgccggagagg
ttcaggcgcagggaggataggcctactggacctcgccctggtggtgctggtggacctggt
gcccctgctgctgctggacctggtggcccccctaatgttgctcgcacctaa

DBGET integrated database retrieval system