KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327631
Entry
4327631           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC4327631
  KO
K01246  DNA-3-methyladenine glycosylase I [EC:3.2.2.20]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    4327631
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:osa03400]
    4327631
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.20  DNA-3-methyladenine glycosylase I
     4327631
DNA repair and recombination proteins [BR:osa03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     4327631
SSDB
Motif
Pfam: Adenine_glyco
Other DBs
NCBI-GeneID: 4327631
NCBI-ProteinID: XP_015624561
UniProt: Q5VQI7 Q0JII6
LinkDB
Position
1:33837378..33840420
AA seq 391 aa
MCNSNVKSAGVAQIDGRPVLQPAGNRVAAPEAARPLKKSLQKSLSMPASLDNAAAATTCA
ASPEKSRAADFARAAAASLLPPPTPASVSAKATRVSGAKVAAARTAAAAAAMGGLDRSRK
PAKKGGAAVLPVVTFAGLEAYEPAGSIAAAQREHVAMAQAQRKMRIAHYGRTASFSRVEG
KVSATATGAAELVAGAVTGHDEKRCSFITPYSDPLYVAYHDEEWGVPVRDDELLFEMLTL
SGVQVGADWTSILKRRHVYREAFSGFNVDAVAKYTEKQMASLSAEFGLDLGTIRGAVNNA
CRISEVRRDFGSFSKYVWAFVNNKPLSPSYKYSRKIPVKTSKSESISKDMVRRGFRFVGP
TVIHSFMQAVGLTNDHLVSCPRHRVCSSSSA
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgtgcaactccaacgtgaagtccgccggcgtcgctcagatcgacggccgcccggtgctg
cagccggcggggaaccgcgtggcggcgcctgaagctgcccggccgctcaagaagtccctg
cagaagtcgctctccatgccggcttcgctcgacaatgctgcggccgcgaccacctgcgcg
gcgtcccccgagaagtcccgcgccgccgacttcgcccgcgctgcggcggcgtctcttctc
ccaccacctactccagcttcggtcagtgctaaggcgacgagggtgtctggagccaaggtg
gctgccgccaggactgcggcggcggctgcggccatggggggcttggacaggagcaggaag
cccgccaagaagggcggcgccgccgtgctgccggtggtgacgttcgcggggctcgaggcg
tacgagcccgccgggagcatcgcggcggcgcagcgggagcacgtcgcgatggcgcaggcg
cagcgcaagatgcggatcgcgcactacggccgcaccgcgtccttctcccgagtcgaaggg
aaagtcagcgctaccgcgacgggtgccgccgagctcgtcgccggtgccgtcaccgggcat
gacgagaagcgatgcagcttcatcactccatattcagaccccctgtacgtcgcctaccac
gacgaggagtggggtgtgcccgtgcgcgacgacgagttgctgttcgagatgctcacgttg
tccggcgtgcaagtcggggcggactggacctcgatcctgaagaggagacacgtctacagg
gaggcattctccggtttcaacgtggacgctgtcgccaagtacacggagaagcagatggca
tcgctaagcgccgagttcggcctggatttgggcaccatcagaggcgccgtcaacaacgcc
tgccggatttccgaggtgaggagggacttcgggtcgttcagcaaatacgtgtgggcgttc
gtaaacaacaagccgctgtcgccgagctacaaatacagccggaagatcccggtgaagacg
tccaagtcggagtcgatcagcaaggacatggtgcggcgcggcttccggttcgtcggcccc
accgtcatccactcgttcatgcaggccgtcgggctcaccaacgaccacctcgtgtcatgc
ccgcgccaccgcgtctgctcctcctcctccgcttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336309
Entry
4336309           CDS       T01015                                 
Name
(RefSeq) probable GMP synthase [glutamine-hydrolyzing]
  KO
K01246  DNA-3-methyladenine glycosylase I [EC:3.2.2.20]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    4336309
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:osa03400]
    4336309
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.20  DNA-3-methyladenine glycosylase I
     4336309
DNA repair and recombination proteins [BR:osa03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     4336309
SSDB
Motif
Pfam: Adenine_glyco
Other DBs
NCBI-GeneID: 4336309
NCBI-ProteinID: XP_015634000
UniProt: B7EG11 A0A8J8XYK3
LinkDB
Position
4:25017119..25020540
AA seq 383 aa
MSGANARGRLSPASGGGGDSEPRSAGSRTRSVSATRGRKPSPRPGRDAAAAAAEEKKPAA
VPTLLPSLSVPAGMRRQELLLRSGLSLDASCSSDASTDSFCSRASTGRIGRPTFGARKKK
TLCQTDHKIVSMLEREVGLASANDVPGLKRRCSWVTANTEPCYAAFHDEEWGVPVHDDKV
LFELLVLSGALAELTWPTILNKRPIFREVFMDFDPVLVSKLSEKKIIAPGSPSSTLLSEQ
KLRGVIENARQILKIVEEFGTFDKYCWSFVNNKPILSRFRYPRQVPVKTSKADAISKDLV
RRGFRSVGPTVVYTFMQVSGMTNDHLISCYRFAECAAAATGSNTTVGSETNSDSSNRATE
QQMNGTNGLAADIARTIDELSIS
NT seq 1152 nt   +upstreamnt  +downstreamnt
atgtccggggctaacgcgagggggcggctctcgccggcttccggcggcggtggagactct
gagccgcggtctgcggggagcaggacgcggtcggtttccgctacaaggggacggaagccg
tcgccgaggcctgggagggatgcggcggcggcggcggcggaggagaagaagcccgccgcg
gtgcccacattgctgccctcgctcagtgtgccggcagggatgcgcaggcaggagctgctg
ctgcgctcggggctgtcgctcgacgcgtcgtgctcgtcggacgcatccacggactcgttc
tgcagccgggcgtccacggggcggattgggaggccgacgtttggggctaggaagaagaag
actctctgtcagactgatcacaagattgtttccatgctggaaagggaggttggattggct
tctgctaatgatgtgcctggtctgaagaggaggtgttcatgggtgacagctaatactgaa
ccctgttatgctgcatttcatgacgaagaatggggagttccagttcatgatgacaaggtg
ttgtttgagttgctggtgctctcaggtgcattggctgaacttacatggccaacaattctg
aacaagagacctatattcagggaggttttcatggattttgaccctgtattggtctctaaa
ctaagtgaaaagaagattattgcacctggaagtcctagcagtaccttgttatctgaacaa
aaactgcgtggtgtcattgaaaatgcacgccaaatactcaagattgtagaggagtttgga
acgtttgataagtattgttggagctttgtgaacaacaaacctattttgagcagattcagg
tatccccgccaggttcctgtcaaaacatctaaagcggatgcgataagcaaagatttggtt
cgcagggggttccgtagcgtaggcccaacagttgtctacacgtttatgcaagtttcaggc
atgaccaatgaccacttgatctcctgctaccggtttgctgaatgcgctgctgcagcaact
ggttctaacacaactgttgggagcgaaacgaattcagacagtagcaatcgtgccacggaa
cagcagatgaatggaaccaatggactagctgctgatattgcacgtacaatagatgaactt
agcatttcatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341682
Entry
4341682           CDS       T01015                                 
Name
(RefSeq) probable GMP synthase [glutamine-hydrolyzing]
  KO
K01246  DNA-3-methyladenine glycosylase I [EC:3.2.2.20]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    4341682
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:osa03400]
    4341682
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.20  DNA-3-methyladenine glycosylase I
     4341682
DNA repair and recombination proteins [BR:osa03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     4341682
SSDB
Motif
Pfam: Adenine_glyco
Other DBs
NCBI-GeneID: 4341682
NCBI-ProteinID: XP_015641809
UniProt: A0A0P0WZD8
LinkDB
Position
6:complement(26569402..26572469)
AA seq 428 aa
MAASMAGAPRVRSLNVAETDADARPVLVPGGNKARSGPAAARKPSPKPLRKADTAARTPE
KPAAAAAAAAPPAKEEEGAKKNAGGGVGKGSSPLPSPRRAQPQPPPARKAAHDAPVHLNL
SLNASCSSDASVESLRGRDSSGGRLERSWSRVAPAVPRRGKTPVKAAAAAAAAEKVAADA
EVVAPATPEAGKRRCAWVTPTSDPCYVIFHDEEWGVPVHDDRRLFELLVLSGALAELTWP
EILKRRQLFREIFVDFDPVAISKINEKKLVAPGSVANSLLSEQKLRAVVENARQILKIVD
EFGSFDRYCWGFLNHKPIVSKFRYPRQVPVKSPKADMISKDMVRRGFRGVGPTIIYSFMQ
AAGLTNDHLVSCFRFKECNEAPTLCTSDTSNANSEADLSADELRTKICSKEMAAKAELLR
TIGTLIIS
NT seq 1287 nt   +upstreamnt  +downstreamnt
atggcggcttccatggccggagcgccgagggtccggtcgctgaacgtggcggagacggac
gcggacgcgaggccggtgctggtgccgggtggcaacaaggccaggtcgggccccgccgcc
gcccggaagccctcgccgaagccgctgcggaaggcggacacggcggcgaggacgccggag
aaacccgccgccgccgccgccgccgccgctcctccggccaaggaggaggagggcgccaag
aagaatgccggcggcggcgtgggcaagggctcgtcccccttgccgtcgccgaggcgggcg
cagccgcagccgccgccggcgaggaaggcggcgcacgacgcgcccgtgcacctcaacctg
tcgctcaacgcgtcctgctcctcggatgcctccgtggagtcgctccgcggccgggactcc
tccggtgggaggctggagaggagctggtccagggtggcgcccgccgtgccgaggcggggg
aagactccagtgaaggcggcggcggcggcggcggcggcggagaaggttgccgccgatgcg
gaggttgtcgcaccggccacaccggaggcggggaagaggaggtgcgcgtgggtgactccg
accagtgatccttgctatgtcatcttccatgatgaggagtggggtgttccagttcatgat
gacaggagattgtttgagctgcttgtactgtctggtgcattggccgagctcacatggcct
gaaattcttaaaaggaggcaacttttcagggaaattttcgtggacttcgatcctgttgct
atctctaaaataaatgagaagaagcttgtagcaccaggaagtgttgccaactcccttctg
tcagagcaaaaactccgagcagttgttgaaaatgctcgacagatacttaagattgtagat
gaatttggatccttcgatcgatactgttggggctttttgaaccacaagccaatagtgagc
aaattccgatatccaaggcaagtccctgtcaagagccccaaggcagacatgatcagcaaa
gacatggtccgaaggggtttccgaggcgtgggcccaacaatcatatattccttcatgcag
gcagcagggctgaccaatgatcaccttgtcagttgctttcggttcaaagaatgcaatgaa
gctccaactctttgcacgagtgatactagcaatgcaaattcagaggcagatctaagtgca
gatgaactgagaacaaaaatctgcagcaaggagatggctgcaaaagcagagctgttgagg
acgatcggtacgcttatcatttcatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347081
Entry
4347081           CDS       T01015                                 
Name
(RefSeq) probable GMP synthase [glutamine-hydrolyzing]
  KO
K01246  DNA-3-methyladenine glycosylase I [EC:3.2.2.20]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    4347081
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:osa03400]
    4347081
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.20  DNA-3-methyladenine glycosylase I
     4347081
DNA repair and recombination proteins [BR:osa03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     4347081
SSDB
Motif
Pfam: Adenine_glyco
Other DBs
NCBI-GeneID: 4347081
NCBI-ProteinID: XP_015610814
UniProt: Q69Q89 Q6ERQ1
LinkDB
Position
9:complement(15135198..15139468)
AA seq 411 aa
MSSPVASSRVAAGAGAARRSSPSPGPRPAAGSSVVRDKDATTMMRRRLYQQQHPPSSSGA
REPGVPSMLLRRAAGGGGGGPRSLNVSCASEASNDSFCSRASTGRIGRRPVGPPGVGAAH
ALRRAAGSAGPPAARPVARKAAASVAPDVAASLIAVANGEAAPALTGPPRCPWVTPNTDP
CYAAFHDHEWGVPVHDDKKLFEMLVLSGALAEMTWPAILSKRETFKEVFMDFDPLLVAKL
SERKILGPCSPARSLLSEHRLRIIIENAQEVLKVIEEFGSFDNYCWGFLNSKPMVGRFRH
PREVPMKTPKADAMSQDLLRRGFLGVGPTVIYAFMQAVGMANDHLVTCYRFGECCSCSSS
TEAPAAAAMDGADNHSKSMVKDQEVNMICGLVECVSLEPSRARATTVLSIS
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgtcgtcgccggtggcgtcgtccagggtggccgccggcgccggcgccgcgcggaggtcg
tccccgtctcctggcccgaggccggctgctggaagcagcgtcgtcagggacaaggacgct
actaccatgatgaggaggaggctgtaccagcagcagcacccgccgtcgtcgtccggcgca
agggagccgggggtgccgtccatgctgctgcgccgtgcggcgggcggcggcggcggcggg
ccgcggtcgctgaacgtgtcgtgcgcgtcggaggcgtcaaacgactcgttctgcagccgg
gcgtccaccggcaggatcgggcgccggccggtgggcccgcccggcgtcggcgccgcgcac
gccctgcggagggcggccgggtcggcggggccgcccgccgctcgcccggtggcccggaag
gcggcggccagcgttgcgccggacgtcgcggcgtcgctgatcgccgtggcgaacggcgag
gccgcgccggcgttgacggggccgccgaggtgcccctgggtcactcctaacactgatcca
tgctatgctgccttccatgaccatgaatggggagtcccggtgcatgatgacaagaaattg
tttgagatgctagtcctgtctggtgcattggctgaaatgacatggcctgcaattctcagc
aagagggaaacattcaaggaggttttcatggactttgatcctctattggtagcaaagcta
agtgagaggaaaattctggggccatgcagccctgcaaggtctctcctgtcagagcatagg
ctgcgtataatcattgaaaatgcacaggaggtcctaaaggtcatagaggagtttggatca
tttgacaactactgctggggcttcctgaacagcaagccgatggttggcagattccggcac
ccgcgggaggtgccgatgaagacgccgaaggccgacgccatgagccaggacctgctccgg
cgaggcttcctcggcgtcgggccgacggtgatctacgccttcatgcaggccgtcggcatg
gccaatgaccacctcgtcacctgctaccgcttcggcgagtgctgcagctgcagcagcagc
actgaagctcctgccgccgccgccatggatggcgctgacaatcacagcaagagcatggtg
aaagatcaggaggtgaacatgatctgtggattggtcgagtgcgtcagcttggagccgtcg
agagctagagccaccaccgtgctcagcatctcctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9272626
Entry
9272626           CDS       T01015                                 
Name
(RefSeq) DNA-3-methyladenine glycosylase
  KO
K01246  DNA-3-methyladenine glycosylase I [EC:3.2.2.20]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    9272626
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:osa03400]
    9272626
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.20  DNA-3-methyladenine glycosylase I
     9272626
DNA repair and recombination proteins [BR:osa03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     9272626
SSDB
Motif
Pfam: Adenine_glyco PI-PLC-Y
Other DBs
NCBI-GeneID: 9272626
NCBI-ProteinID: XP_015648290
UniProt: B9G1I6 Q6ZBQ9
LinkDB
Position
8:24186636..24189444
AA seq 339 aa
MLTTSSHSRHHHAFERSPNHSMMKNIADRNKHDLLQSAMNHAASKYMQRIYPLGIQRSSS
NLTLSSLSLSQNSNDSSLSSSNSSWEPKVPLLYGGTFSPWGDVLVSLERRREEDDDKVSD
HDVEGGEEDFDCSEPGSLHRCSWITKNSDEAYVQFHDECWGVPVYNDNRLFELLALSGML
IDHNWTEILKRRDMYREAFADFDPSTVAKMDENDVAEISGNKELKLAECRVRCIIENAKC
IQKVAKEFGSFSGYIWGHVNHRPTVGRYKHHKYIPFRTPKSEAVSKDLVRRGFRLVGPVI
VYSFMQASGIVIDHLVDCFRFPECLHLADRSWGITNVAA
NT seq 1020 nt   +upstreamnt  +downstreamnt
atgctcaccacatcatcacatagcaggcaccaccatgcatttgagaggagccccaaccac
agcatgatgaagaacatagcagacaggaacaagcatgatcttcttcagagtgccatgaac
catgcagcaagcaagtacatgcagaggatctaccctctggggatccagaggagcagctcc
aacctcacactctcatcactctccctgtcacagaactccaatgattcttcactcagcagc
tcaaactctagctgggagcccaaggtgcccctgctgtatggtggcacatttagcccctgg
ggtgatgtgcttgtgtccctggagaggaggagggaagaagatgatgacaaggttagtgat
catgatgttgaggggggagaagaggattttgattgcagtgagcctgggagcttgcatagg
tgcagctggatcaccaagaacagtgatgaggcgtacgttcagtttcacgacgagtgctgg
ggtgtcccagtgtacaacgacaaccgtctgttcgagctgcttgcgttgtcaggcatgctc
atcgaccacaactggactgagatactcaagagaagagacatgtacagggaagcgttcgcg
gacttcgatcccagcacggtggcgaagatggacgagaacgacgtcgcggagatcagcggc
aacaaggagctcaagctggccgagtgcagggtccggtgcatcatcgagaacgccaaatgc
attcagaaggtggcgaaggagtttgggtcgttcagcggatacatatgggggcacgtgaac
caccggccgacggtggggaggtacaagcaccacaagtacatcccgttccggacgcccaag
tcagaggcggtgagcaaggacctcgtccgccgcggcttccgcctcgttggccccgtcatc
gtctactccttcatgcaggcctccggcatcgtcatcgaccacctcgtcgactgcttccgc
ttccctgaatgcctccacctcgccgaccgctcctggggcattaccaacgtcgctgcctaa

DBGET integrated database retrieval system