KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327674
Entry
4327674           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L28-1
  KO
K02903  large subunit ribosomal protein L28e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4327674
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4327674
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4327674
SSDB
Motif
Pfam: Ribosomal_L28e Sfi1
Other DBs
NCBI-GeneID: 4327674
NCBI-ProteinID: XP_015621869
UniProt: A0A0P0V753
LinkDB
Position
1:29314110..29316912
AA seq 145 aa
MATIPDSLVWELVKKNNSFLVKQFGNGNAKVQFSKEPNNLYNVHSYKHSGLANKKTVTVQ
PASGKETAVVLSTTKTEKQNKPASLYHKSVMRKEFRKMAKAVKNQVSDNYYRPDLTKPAL
ARLSAVYRSLQVAKSGVKKKNRQAN
NT seq 438 nt   +upstreamnt  +downstreamnt
atggccacgattccagattctctggtctgggagcttgtcaagaagaacaattcattcctg
gtcaagcagttcggcaatggcaatgccaaggttcagttcagcaaggagcccaacaacctg
tacaatgtccactcttacaagcattctggcctggcaaacaagaaaaccgtgacggtccag
cctgccagtggtaaggaaacggcagtggtcctctctacaaccaagacagagaagcagaac
aagcctgctagcctctaccacaagtctgtcatgcgcaaggagttccgcaaaatggccaag
gctgtcaagaaccaggtcagcgacaactactaccggcctgaccttaccaagccagcactt
gcaaggctgagcgcagtctaccgcagcctccaggttgccaaatctggtgtcaaaaagaag
aacaggcaggcaaactaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331176
Entry
4331176           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L28-1
  KO
K02903  large subunit ribosomal protein L28e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4331176
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4331176
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4331176
SSDB
Motif
Pfam: Ribosomal_L28e Sfi1 MmeI_C
Other DBs
NCBI-GeneID: 4331176
NCBI-ProteinID: XP_015622689
UniProt: Q6KA14
LinkDB
Position
2:complement(35256180..35258258)
AA seq 147 aa
MATVPEPLFWEIVKKNNCFLVKQFGNSNAKVQFTKEPNNLYNVHSYKHSGLANKKTVTIQ
PSGGKDAAVVLSTTKTKKQNAPAKLYHKSVMRKEFRKMAKAVKNQVSDNYYRPDLTKPAL
ARLSSVYRSLQVAKSGVKKKNRQPAKL
NT seq 444 nt   +upstreamnt  +downstreamnt
atggcgacggttccggagcctttgttctgggagattgtgaagaagaacaactgcttcctc
gtgaagcagtttggaaacagcaatgccaaggtgcagttcaccaaggagcccaacaacctg
tacaatgttcactcctacaagcactctggcttggcgaacaagaagaccgtgacgatccag
ccatcaggtggaaaggacgcggctgtggtcctctccacgaccaagaccaagaagcagaat
gccccagctaagctctaccacaagtctgtgatgcgcaaggagttccgcaagatggctaag
gctgtcaagaaccaggttagtgacaactactacaggccagatctgaccaaaccggctctt
gcaaggcttagctcagtgtaccgcagcctccaggttgccaagtctggtgtgaagaagaag
aacaggcagccagccaagctgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339475
Entry
4339475           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L28-1
  KO
K02903  large subunit ribosomal protein L28e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4339475
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4339475
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4339475
SSDB
Motif
Pfam: Ribosomal_L28e Sfi1 MmeI_C
Other DBs
NCBI-GeneID: 4339475
NCBI-ProteinID: XP_015639693
UniProt: Q5TKP3
LinkDB
Position
5:complement(26902010..26905095)
AA seq 147 aa
MATVPEPLIWEIVKKNNCFLVKQFGNSNAKVQFTKEPNNLYNVHSYKHSGLANKKTVTIQ
PSGVKDAAVVLSTTKTKKQNAPAKLYHKSVMRKEFRKMAKAVKNQVSDNYYRPDLTKPAL
ARLSSVYRSLQVSKSGAKKKNRQPTKL
NT seq 444 nt   +upstreamnt  +downstreamnt
atggcgacggttccggagcctttgatctgggagattgtcaagaagaacaactgcttcctg
gtgaagcagttcgggaatagcaatgccaaggtgcagttcaccaaggagcccaacaacctg
tacaatgtccactcctacaagcactctggcttggcgaacaagaagaccgtgacgatccag
ccatcaggcgtgaaggacgcggccgtggtcctctccacaaccaagaccaagaagcagaat
gccccagcgaagctctaccacaagtctgtgatgcgcaaggagttccgcaaaatggctaag
gctgtcaagaaccaggtgagtgacaactactacaggcctgacctgaccaagccggctctt
gcgaggcttagctcagtgtaccgcagcctccaggtttccaagtctggtgccaagaagaag
aacaggcagccaactaagctgtaa

DBGET integrated database retrieval system