KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327823
Entry
4327823           CDS       T01015                                 
Name
(RefSeq) 5'-nucleotidase SurE
  KO
K03787  5'/3'-nucleotidase [EC:3.1.3.5 3.1.3.6]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa00240  Pyrimidine metabolism
osa00760  Nicotinate and nicotinamide metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4327823
   00240 Pyrimidine metabolism
    4327823
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    4327823
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     4327823
    3.1.3.6  3'-nucleotidase
     4327823
SSDB
Motif
Pfam: SurE
Other DBs
NCBI-GeneID: 4327823
NCBI-ProteinID: XP_015617688
UniProt: Q0JJY1 A0A0P0V787
LinkDB
Position
1:29479113..29482677
AA seq 418 aa
MAASSGDDAPRPNPLPSALVSNLQSVLAARRPPPPAAEEAGAEAPAPEAAESSGAAPVAD
EGPAKPAVLLTCAGGIRAPGLAALVDSLVAGGRCDVHVCAPESDKPACGYSITIRETITA
TSVDFKGAKAFEISGTPVDCVSLALSGRLFSWSAPALVISGINAGANCGYEMFHSSAIAA
AREALLYDVPSIAISLNWKKDESKDSDFKDAAEVCLPLIHAALEGVEKGTFLRGCLLNIG
VPSSPTTNKGFKLTKQSIYRPAQSWEGVSTSRPTPATHFMGMHQSLGIQLAQLGKDASAA
GAARRINAQRKIVEVESVASTGKAEAREVVKKLFRAEFTEKQHECLDEDIDLRALENGFI
SVTPLNIHGNVAPETGAPASDWLSVAVGLDKAKEDSVVTAEEQDAPAVAEEKEAPSAT
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggccgcgagctccggcgacgacgcgccgaggcccaatccgctcccgtccgcgctcgtg
tccaacctgcagtccgtcctcgcggcgcgccggccgccgccgccggccgcggaggaggcc
ggcgccgaggccccggcaccggaggcggcggagtcctccggcgctgctcccgtggccgat
gaaggtcccgcgaagccggccgtactcctgacctgcgccggcgggatccgggcgccgggt
ctcgcggccctcgtcgactccctcgtcgccggcggccgatgcgacgtccacgtatgcgcg
cccgaatcggacaagcctgcttgcggctattccattaccatccgcgagaccattacagca
acatcggtggatttcaaaggggcgaaagctttcgagatatcagggacaccggtggattgc
gtctctttggcattatctgggaggctgttctcttggtcggcgcctgctttggtgatcagt
gggatcaatgcaggggcgaactgtggatatgagatgtttcattcttctgccattgctgct
gcaagggaggccttactgtatgatgttccttcaattgcaatatcattgaattggaagaag
gatgaaagcaaagatagtgatttcaaggatgctgctgaggtttgcctaccattgatacac
gctgccttggaaggcgttgagaaaggaaccttcctcagaggctgcttactgaacattggg
gttccaagctcaccaactacaaataagggtttcaagctgactaagcaaagcatatatcgt
cctgcccaaagttgggaaggtgtgtccacaagcagacctacacctgctactcacttcatg
ggcatgcaccaaagccttggtattcagctcgcacaacttgggaaggatgcatctgcagca
ggggctgcacgcagaattaatgctcagcggaagattgtcgaggttgagtctgttgcatct
acagggaaagcagaggctcgagaagtagtgaagaagcttttccgtgctgagttcactgaa
aagcagcatgaatgcttagacgaggatatcgatttgagagctttggagaatggatttata
tctgtcactcctctgaatatacacggaaatgtggctcctgaaactggagcacctgcttca
gattggctctcggtagctgtgggtctagacaaagcaaaggaagattctgtagttacagca
gaagaacaagatgctccagctgtagctgaggaaaaggaagctccttcagcaacctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333582
Entry
4333582           CDS       T01015                                 
Name
(RefSeq) 7-methylguanosine phosphate-specific 5'-nucleotidase A
  KO
K24242  7-methylguanosine nucleotidase [EC:3.1.3.91]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00240  Pyrimidine metabolism
osa01100  Metabolic pathways
osa01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    4333582
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.91  7-methylguanosine nucleotidase
     4333582
SSDB
Motif
Pfam: UMPH-1 HAD PS_pyruv_trans
Other DBs
NCBI-GeneID: 4333582
NCBI-ProteinID: XP_015631792
UniProt: Q60DI6 A0A0P0W0Q9
LinkDB
Position
3:25142507..25146180
AA seq 354 aa
MRPMTSPPLLSPSSSSSRLLLLRLLLSRRRSPASRSPPPPLRRRLPLLAASMSSSSSTAA
TRNPGSVVADADGLARKVAAIRAAGPAKLQVIADFDGTLTRYWYDGSRGQSSHGLLRQGN
EEYDAKREELFEHYHPIEICPDIPLPEKAKLMEEWWEKTHALLIEGGLTYEAIRQSVADA
KITFRDGVVKLFEFLEERDIPVLVFSAGLADIIEEVFRQKLHRSFKNIKVVSNRMVFNEE
GRLVSFKGKTIHVLNKNEHALDMAAPVHDNLGDPNGYTDDYSLVKKRTNVLLLGDHIGDL
GMSDGLNYENRIAVGFLNNNIEKSLKDYSEAFDIVYLNDAPMVGVVELVSELCP
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgcggcccatgacgagcccacctctcctctcgccctcctcctcctcctcccgtctcctc
ctcctccgcctcctcctctcccgccgccggagccccgcctcgcgctcccctcctcctccc
ctccgccgccgcctccctctcctcgctgcctccatgtcctcctcctcctccaccgccgcc
accagaaaccccggctccgtcgtcgccgacgccgacggcctcgcccgcaaggtcgccgcc
atccgcgccgccggccccgctaagctccaggtcatcgcggacttcgacggcacgctcacg
cggtactggtacgacggctcccgcggccagagcagccatgggttgctgaggcaggggaac
gaggagtacgacgccaagagggaggagctgttcgagcactaccaccccatcgagatctgc
cccgacatcccgctccccgagaaggccaagctcatggaagaatggtgggagaagacacat
gctctccttatcgaaggtggacttacatatgaagctataaggcaatctgtggctgatgct
aaaatcacttttagagatggagtggtgaagctctttgagttcttggaggagagagatatt
ccagtattagtattttctgctggacttgcagacataattgaggaggtcttccggcagaaa
ctccacagatcattcaagaacattaaggttgtgtccaacaggatggtcttcaatgaagaa
ggtcgtcttgtttcatttaaaggaaagactattcatgttctaaacaaaaatgagcatgcc
ttggacatggcagctccagtgcatgacaatttgggtgatccaaatggatatactgatgac
tattcgttggtgaagaagaggaccaatgtgcttctccttggagatcacattggcgacctt
ggaatgtctgatggtctaaactatgaaaacaggattgctgttggatttctgaacaacaac
atcgagaaatctctaaaagattactccgaggcatttgatattgtctacttgaatgacgcg
ccaatggtgggagttgttgagcttgtatctgaactatgtccttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342678
Entry
4342678           CDS       T01015                                 
Name
(RefSeq) 5'-nucleotidase SurE isoform X1
  KO
K03787  5'/3'-nucleotidase [EC:3.1.3.5 3.1.3.6]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa00240  Pyrimidine metabolism
osa00760  Nicotinate and nicotinamide metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4342678
   00240 Pyrimidine metabolism
    4342678
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    4342678
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     4342678
    3.1.3.6  3'-nucleotidase
     4342678
SSDB
Motif
Pfam: SurE TraW_N CreA
Other DBs
NCBI-GeneID: 4342678
NCBI-ProteinID: XP_015647703
LinkDB
Position
7:complement(5613818..5623722)
AA seq 312 aa
MDSSAASAAAAAAAPVVLVTNDDGIDAPGLRFLVGQLVAARRYRVLVCAPDTDRSGVSHS
ITWRPALRCKRVDIDGATAFAASGTPADCASLGISGKLFDGLVPDLVVSGINVGNNCGCH
VIYSGTVGGAREAFLYGIPSLAMSYDWVASQSSVNDLKVAAEVVMPLINNVMAEIKNGTY
PQGSFLNIDIPTDAAHHKGYKITKQGRYMARIGWEQTVYKKPAVESYQTANMDVDSEKDS
EVDTSSENDLLFKRVLVRRSYDEEEGDDIDHKCLVDGYITVTPLGALSRAEADVIPYYKA
CLSRDQDTFVAH
NT seq 939 nt   +upstreamnt  +downstreamnt
atggactcctccgcggcgtcggcggcggctgcggcggcggcgccggtggtgctggtgacg
aacgacgacggcatcgacgcgccgggactccgcttcctcgtcggccagctcgtcgccgcc
cgccgctaccgcgtcctcgtctgcgcgcccgacacagacaggtcaggtgttagccactcc
atcacatggcgccctgcactccgctgtaaacgagttgatatagatggtgctacagcattt
gcagcctcagggactcctgctgactgtgcttctttaggcatatctgggaagctctttgat
ggtttggttcctgatctggtagtcagtggaatcaatgttggcaacaattgtggatgccat
gttatctattctggaacagttggcggtgctagggaggcattcttgtacgggattccttca
ttagccatgtcatatgattgggtcgcaagtcagagcagtgttaacgacctcaaagtagct
gcagaggttgttatgcctctgataaataatgtgatggctgagataaagaatgggacatat
cctcaaggatcattcttgaatatagatataccaactgatgctgcacaccacaagggatac
aaaattacaaagcaaggaaggtatatggccagaattggttgggagcaaacagtttataag
aagcctgcggtagaaagttaccagacagcaaacatggatgttgacagtgaaaaggacagt
gaagtagatacttcatcagagaatgacctattgtttaaaagagtgcttgtgaggcgaagt
tatgatgaagaggaaggggatgatatcgaccacaagtgccttgtagatggatatattact
gttacccctttgggagctctatcccgcgcagaagctgatgtcataccatactacaaagct
tgcttgtcacgtgatcaggatacttttgtggcccactaa

DBGET integrated database retrieval system