KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327828
Entry
4327828           CDS       T01015                                 
Name
(RefSeq) probable polyamine oxidase 5
  KO
K12259  spermine oxidase [EC:1.5.3.16 1.5.3.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00330  Arginine and proline metabolism
osa00410  beta-Alanine metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    4327828
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    4327828
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.3  With oxygen as acceptor
    1.5.3.16  spermine oxidase
     4327828
    1.5.3.-
     4327828
SSDB
Motif
Pfam: Amino_oxidase NAD_binding_8 NAD_binding_9 DAO FAD_binding_2 Pyr_redox_2 HI0933_like Thi4 Lycopene_cycl Pyr_redox FAD_oxidored
Other DBs
NCBI-GeneID: 4327828
NCBI-ProteinID: XP_015630114
UniProt: Q5NAI7
LinkDB
Position
1:complement(29513103..29516065)
AA seq 512 aa
MVAKKPRVVVVGAGISGLAAAHRLCGAGGDRFEVAVVEAGDRVGGRILTSEFAGHRVEMG
ATWVQGVVGSPVYALARDAGALGEEEGRGLPYERMDGFPDRVLTVAEGGEVVDADTVAGP
IEELYRGMMEAARAGEAGGGGGVEEYLRRGLRAYQAARSAGGGGGGGKELEEVDEALLAM
HINRERTDTSADDLGDLDLTAEGEYRDFPGEHVTIPGGYSRVVERLAAALPPGTVRLGLR
LRRLKWGGTPVRLHFADGAPPLTADHVILTVSLGVLKASLGNKDTAGVGAAAIAFDPPLP
PFKREAVARLGFGVVNKLFMEVEAVAPSEPEDVAGVQPAAAGFPFLHMAFRGHVSKIPWW
MRGTESICPVHAGSTVALAWFAGREAAHLESLPDDDVIRGAHATLDSFLPAAPRWRVRRI
KRSGWATDPLFLGSYSYVAVGSSGDDLDRMAEPLPRGPDAAADERPPSPRLLFAGEATHR
THYSTTHAAYLSGVREANRLLQHYRGGANHTT
NT seq 1539 nt   +upstreamnt  +downstreamnt
atggtggcgaagaagccgagggttgtggtggtgggcgcggggatatcgggcctcgcggcg
gcgcaccggctgtgcggcgcgggcggggacaggttcgaggtggcggtggtggaggccggc
gaccgagtcggcggccggatcctcacgtccgagttcgccggccaccgggtcgagatgggc
gccacgtgggtgcagggcgtcgtcgggagccccgtgtacgctctggcgcgcgacgccggc
gcgctcggggaggaggagggtcgtggtctcccgtacgagcgcatggacggcttccccgac
cgcgtgctgaccgtcgcagagggcggcgaggtcgtcgacgcggacacggtggctggcccg
atcgaggagctgtacaggggcatgatggaggccgcgcgcgccggcgaggctggtggtgga
ggcggcgtggaggagtacctgcgccgtggcctacgggcgtaccaggcggcgcggtctgcc
ggcggcggcggcggcggcggcaaggagcttgaggaggtggacgaggcgctgctcgccatg
cacatcaaccgggagcggaccgacacctccgccgacgacctcggcgacctcgacctcacc
gccgagggcgagtaccgcgacttccccggcgaacacgtcacgattcccggcggctactcc
cgcgtggtcgagcgcctcgccgctgcgctcccgcccggcaccgtccgcctcggactccgt
ctccgccgtctcaagtggggcggaacccctgtccgcctccacttcgcggatggcgcgccg
ccgctcaccgccgaccacgtcatcctcacggtctcgctgggcgtcctcaaggccagcctc
ggcaacaaggacaccgccggcgttggcgcggccgccatcgccttcgacccgccgctcccg
cctttcaagcgcgaggccgtcgcgcgcctcggcttcggcgtcgtgaacaagctgttcatg
gaggtggaggccgtggcgccatcggaaccggaggacgtcgccggcgtgcagccggcggcg
gcgggcttcccgttcctgcacatggcgttccggggacacgtgtccaagatcccgtggtgg
atgcgcggcacggagtcgatctgccccgtccacgcgggctccaccgtggcgctggcgtgg
ttcgccggccgggaggcggcgcacctcgagtccctccccgacgacgacgtcatccgcggg
gcccacgccacgctggactccttcctcccggcggcgccacggtggagggtgaggaggatc
aagcggagcgggtgggccacggacccgctcttcctcgggtcatacagctacgtggccgtc
ggatcgagcggcgacgacctcgatcgcatggccgaaccgctgccacgtgggccagacgcc
gccgccgacgagcggccgccgtcgccgcggctgctgttcgccggcgaggcgacgcaccgc
acgcactactcaacgacgcacgccgcgtacctgagcggcgtgcgcgaggctaaccggctg
ctgcaacactaccgcggcggagcgaatcacaccacgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337046
Entry
4337046           CDS       T01015                                 
Name
(RefSeq) probable polyamine oxidase 2
  KO
K17839  polyamine oxidase [EC:1.5.3.17 1.5.3.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00330  Arginine and proline metabolism
osa00410  beta-Alanine metabolism
osa00770  Pantothenate and CoA biosynthesis
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    4337046
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    4337046
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    4337046
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.3  With oxygen as acceptor
    1.5.3.17  non-specific polyamine oxidase
     4337046
    1.5.3.-
     4337046
SSDB
Motif
Pfam: Amino_oxidase NAD_binding_8 FAD_binding_2 Pyr_redox_2 HI0933_like GIDA Pyr_redox FAD_oxidored DAO Pyr_redox_3 Thi4 FAD_binding_3
Other DBs
NCBI-GeneID: 4337046
NCBI-ProteinID: XP_015636130
UniProt: Q7X809
LinkDB
Position
4:complement(31669227..31674594)
AA seq 484 aa
MANNSSYGENVRRKSHTPSAIVIGSGFAGIAAANALRNASFEVVLLESRDRIGGRIHTDY
SFGFPVDLGASWLHGVCEENPLAPIIGRLGLPLYRTSGDDSVLFDHDLESYALYDTKGHQ
VPQELVEKIGKVFETILEETGKLREETKEDISIAKAIAIVMERNPHLRQEGIAHDVLQWY
LCRMEGWFATDADAISLQGWDQEVLLPGGHGLMVRGYRPVINTLAKGLDIRLGHRVVEIV
RHRNRVEVTVSSGKTFVADAAVIAVPLGVLKANTIKFEPRLPEWKEEAIRELSVGVENKI
ILHFSEVFWPNVEFLGVVSSTTYGCSYFLNLHKATGHPVLVYMPAGRLACDIEKLSDEAA
AQFAFSQLKKILPNAAEPIHYLVSHWGSDENTLGSYTFDGVGKPRDLYEKLRIPVDNLFF
AGEATSVQYTGTVHGAFSTGLMAAEECRMRVLERFRELDMLEMCHPAMGEQTATVSVPLL
ISRL
NT seq 1455 nt   +upstreamnt  +downstreamnt
atggcgaacaacagttcatatggtgaaaatgttaggagaaagtcccacacaccttctgct
attgttatcggcagtgggtttgcaggcattgctgcagccaacgctctcaggaatgcatca
tttgaggttgttcttctagaatctcgtgacaggataggtggtagaattcacactgattac
tcttttggctttcctgttgatctgggagcatcctggcttcatggtgtttgtgaggaaaat
cccctggcaccaattattggaaggcttggacttccactgtatcgcacaagtggagatgac
tctgtgctgtttgatcatgaccttgagagttatgctctctatgacactaagggccatcaa
gttccccaagagctggtagaaaagatagggaaggtttttgagactatattggaagagact
ggcaaactgagggaagaaactaaggaagacatttctattgcgaaggccattgcaattgtt
atggagagaaatccacacttgaggcaagaagggattgctcatgatgttcttcagtggtat
ttgtgccgcatggaaggttggtttgctactgatgcggacgcaatctctcttcagggttgg
gaccaggaggtactgcttcctggtggccatggtctcatggttcgtggatatcgtccagta
ataaatactctggcaaaaggcctagatatacgccttggccacagggttgttgagattgtt
cgccacaggaatagggtggaggttactgtaagcagtggtaaaacatttgttgcggatgct
gcagtcattgctgtccccttaggtgttcttaaagcaaacaccattaaatttgaacctagg
ctgccagagtggaaggaggaagcaataagagaactctcagttggagtcgagaacaaaata
attctccacttcagcgaggttttctggcctaatgtggagttccttggagtagtttcatcc
accacatatggctgcagctatttcctcaacctccacaaggctactggccatcctgttcta
gtttacatgcctgcgggtcggcttgcatgtgacattgaaaagctgtcagatgaggctgct
gcccaatttgccttctctcagctgaagaagatcctgcccaacgctgccgagccgatacat
tacctagtgtcacattggggctcagacgagaatacacttggatcctacaccttcgatggg
gtgggcaaacctcgtgacctgtatgagaagctgcggatcccagtcgataacctattcttt
gctggagaagccaccagtgtccagtacactggcacggtgcatggcgccttctccactggt
ctgatggcagctgaggagtgccgaatgagggttcttgagcggttcagggagctggacatg
ctggagatgtgccaccctgcaatgggggagcagaccgccactgtctcagtcccactgctc
atctcccggctgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337359
Entry
4337359           CDS       T01015                                 
Name
(RefSeq) probable polyamine oxidase 2
  KO
K17839  polyamine oxidase [EC:1.5.3.17 1.5.3.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00330  Arginine and proline metabolism
osa00410  beta-Alanine metabolism
osa00770  Pantothenate and CoA biosynthesis
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    4337359
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    4337359
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    4337359
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.3  With oxygen as acceptor
    1.5.3.17  non-specific polyamine oxidase
     4337359
    1.5.3.-
     4337359
SSDB
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox_2 FAD_binding_2 Pyr_redox Pyr_redox_3 NAD_binding_9 HI0933_like FAD_oxidored GIDA AlaDh_PNT_C Thi4 Trp_halogenase HcgC FAD_binding_3
Other DBs
NCBI-GeneID: 4337359
NCBI-ProteinID: XP_015637015
UniProt: Q7XR46
LinkDB
Position
4:complement(34239837..34243205)
AA seq 487 aa
MDPNSLKTGGLLLPTIERQCASPPSVIVIGGGISGVAAARALSNASFEVTVLESRDRVGG
RVHTDYSFGCPIDMGASWLHGVCNENSLAPLIGYLGLKLYRTSGDNSVLYDHDLESYALF
DKAGHQVSKETVAKVEETFERILDETVKVRDEQEHDMPLLQAISLVLERHPHLKLQGIDD
QVLQWCVCRLEAWFAADADEISLKNWDQEHVLTGGHGLMVNGYYPIIQALAQGLDIRLNQ
RVTKIARQFNGVTVTTEDGTSYSADACIITVPLGVLKANIIKFEPELPSWKSSAIADLGV
GIENKIAMHFDTVFWPNVEVLGMVGPTPKACGYFLNLHKATGNPVLVYMAAGRFAQEVEK
LSDKEAVDLVMSHLKKMLPDATEPTKYLVSRWGSDPNSLGSYSCDLVGKPADVSARFAAP
VENLYFAGEAASADHSGSVHGAYSSGIAAADECRKRILMQKGIPDLVQVKAYEEMAGVIA
PLQICRT
NT seq 1464 nt   +upstreamnt  +downstreamnt
atggatcccaatagcctcaaaactggaggcctcttgcttccgaccattgagaggcaatgt
gcttcgcctccatccgtcatcgtgatcggtgggggaatttcaggggttgcagcagcccgt
gctctctccaatgcttcgtttgaggtgactgttttggagtccagagatcgcgtaggcggt
cgtgtccataccgattactctttcggatgcccaattgatatgggagcctcatggctccac
ggcgtttgtaatgagaactccttggcaccattgattggctatcttgggctgaaattatat
cgcactagtggcgacaactctgttctgtatgatcatgatttagaaagttatgcactcttt
gataaggctggccatcaggtctcaaaggagacagttgctaaagttgaagaaacatttgaa
agaattcttgatgagacagttaaagtgcgtgatgagcaggaacatgacatgccccttcta
caggcgatttcacttgttcttgagaggcacccccatctgaagttacaagggatagatgat
caagtcttgcaatggtgtgtctgtcggcttgaggcatggtttgctgcagatgctgatgaa
atatctctgaaaaactgggatcaggagcatgttcttaccggtggccatggtctgatggtg
aacggatactatcctataattcaggctcttgcacaaggtctagatatccggcttaatcaa
agggtaaccaaaattgcccgccaattcaatggagtgacagttaccactgaagatggaaca
agttactctgccgatgcttgcatcattacagtaccgctcggtgtgctcaaggcaaacata
atcaagttcgagcctgagttgccctcatggaagagctctgcaatcgcagaccttggtgtc
ggtatcgagaacaagatcgccatgcacttcgatacagtcttctggcctaatgttgaggtg
ctgggaatggttggcccaacgcctaaagcatgtgggtacttcctgaacctccacaaggcc
accggcaatccggtcctcgtctacatggccgccggtagatttgctcaagaagtggaaaaa
ctgtcagacaaggaggccgttgatctggtcatgtctcacctgaagaaaatgctacctgac
gccactgaacctacgaagtatttggtttcacgctggggttctgacccgaactcgctgggt
tcctactcgtgcgacctggtcgggaagccggccgacgtgtcggcgcggttcgccgcaccg
gtggagaacctctacttcgccggcgaggcggccagcgccgaccactcggggtccgtccac
ggcgcctactcgtcggggatcgccgccgccgatgagtgccggaagcgcatcctgatgcag
aagggcatccctgacctcgtccaggtcaaggcctacgaggagatggccggagtcattgct
ccccttcagatttgcaggacctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337360
Entry
4337360           CDS       T01015                                 
Name
(RefSeq) probable polyamine oxidase 4
  KO
K17839  polyamine oxidase [EC:1.5.3.17 1.5.3.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00330  Arginine and proline metabolism
osa00410  beta-Alanine metabolism
osa00770  Pantothenate and CoA biosynthesis
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    4337360
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    4337360
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    4337360
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.3  With oxygen as acceptor
    1.5.3.17  non-specific polyamine oxidase
     4337360
    1.5.3.-
     4337360
SSDB
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO FAD_binding_2 Pyr_redox_2 FAD_oxidored Pyr_redox NAD_binding_9 HI0933_like GIDA Thi4 AlaDh_PNT_C Pyr_redox_3 HcgC Trp_halogenase FAD_binding_3 Lycopene_cycl
Other DBs
NCBI-GeneID: 4337360
NCBI-ProteinID: XP_015636452
UniProt: Q0J954
LinkDB
Position
4:complement(34244255..34248318)
AA seq 492 aa
MDQPSNGFAAGGLFLRHIDGQNASPPSVIVIGGGISGIAAARALSNASFKVTLLESRDRL
GGRVHTDYSFGCPIDMGASWLHGVCNENSLAPLIRLLGLRLYRTSGDNSVLYDHDLESYA
LFDKDGRQVPQEIVTKVGETFEKILKETVKVRAEHEDDMPLIQAISIVLDRNPHLKLDGL
QYEVLQWCICRLEAWFATDVDNISLKNWDQEHVLTGGHGLMVHGYDPVIKALAQDLDIHL
NHRVTKIIQRYNKTIVCVEDGTSFVADAAIITVPLGVLKANIIKFEPELPDWKLSSISDL
GIGIENKIALRFNSVFWPNVEVLGRVAPTSNACGYFLNLHKATGHPVLVCMVAGRFAYEF
EKLSDEESVNFVMSQLKKMLPGATEPVQYLVSRWGTDPNSLGSYSCDLVGKPADLYERFC
APVGNLFFAGEAACIDHSGSVHGAYSSGIVAAEDCRRHLSTQLGISDLFQVGKIIMREEM
TEVMVPFQISRL
NT seq 1479 nt   +upstreamnt  +downstreamnt
atggaccagccttctaatggcttcgccgccggaggtctttttcttcgtcacattgatggg
caaaatgcctctcccccttctgtcattgtgattggtggagggatttcaggcattgcagct
gctcgtgcgctgtctaatgcttcgtttaaggtcacactattagagtcacgggaccgactt
ggtggccgtgtgcatactgactattcttttggctgcccaattgacatgggagcatcttgg
ttgcatggtgtatgcaatgagaattcattggcaccactgattaggttgcttggccttaga
ttatatcgcaccagtggtgataactctgtgctatatgaccatgatctggagagctatgct
ctctttgataaggatggtcgtcaagttccccaggagatagtgacaaaagtcggggaaaca
tttgagaaaattcttaaggagacggtgaaagtaagagctgaacatgaagatgacatgcct
cttattcaagccatctcaattgtgcttgacaggaatccacacctaaagcttgatggtttg
caatatgaagtactgcagtggtgcatatgtaggctggaggcatggtttgccacagatgtg
gataatatatctctgaaaaattgggatcaggaacatgttcttactggtggccatgggctt
atggtgcatggttatgatcctgttatcaaagctctcgcgcaagatcttgatatccacctg
aaccacagggttaccaaaatcatccagaggtacaacaaaactatagtatgtgttgaagat
gggacaagctttgttgcagatgctgctataataactgtccctcttggtgtacttaaagca
aatatcatcaagtttgaacctgagctcccagattggaagctttcatcaatatctgatctt
ggtattggcattgagaacaaaatagccctccgcttcaatagtgtattttggccaaatgta
gaagtgctaggcagggttgccccaacatcaaatgcctgcggttactttcttaaccttcac
aaagccacagggcatccggttcttgtatgcatggtagcaggaagattcgcatatgaattc
gagaagctatccgatgaagaatccgtaaactttgtcatgtctcagctcaagaaaatgcta
ccaggagctactgaaccggtccagtatttggtttcaaggtggggaaccgacccgaattcg
cttggttcttattcctgcgaccttgttgggaagccagctgacttgtatgaaagattctgt
gctccggtgggcaacctgtttttcgctggggaggccgcctgcatcgatcactctgggtcc
gtgcatggagcttattcttcaggcattgttgctgcagaggattgccgaaggcatctgtcg
acgcagctaggcatctccgaccttttccaggttgggaagattatcatgagggaggagatg
actgaagtcatggtccccttccagatatccaggctgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346881
Entry
4346881           CDS       T01015                                 
Name
(RefSeq) polyamine oxidase
  KO
K13366  polyamine oxidase [EC:1.5.3.14 1.5.3.16 1.5.3.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00330  Arginine and proline metabolism
osa00410  beta-Alanine metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    4346881
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    4346881
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.3  With oxygen as acceptor
    1.5.3.14  polyamine oxidase (propane-1,3-diamine-forming)
     4346881
    1.5.3.16  spermine oxidase
     4346881
    1.5.3.-
     4346881
SSDB
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox_3 Pyr_redox_2 FAD_binding_2 GIDA FAD_oxidored Thi4 FAD_binding_3 HI0933_like
Other DBs
NCBI-GeneID: 4346881
NCBI-ProteinID: XP_015611019
UniProt: A0A0P0XM10
LinkDB
Position
9:complement(12145944..12154427)
AA seq 496 aa
MTKPTTMAIFLVLALSIAQLLPSLVAGTGRPRVIIVGAGISGISAGKRIWEAGIADVLIL
EATDRIGGRMHKQSFAGVNVEIGANWVEGVNGEKKNPIWPIVNSTLKLRSFRSDFDSLAQ
NVYKDGGLCDEAYVQKRMDRADEVDKSGENLSATLHPSGRDDMSILSMQRLNDHLPNGPS
SPVDMAVDYFTYDYEFAEPPRVTSLQNTVPLPTFTDFGDDTYFVADQRGYESVVHHLAGQ
YLNADKSGNIADARLKLNKVVREISYSSTGVTVKTEDNSTYQADYVMVSASLGVLQSDLI
QFKPQLPSWKILAIYQFDMAVYTKIFVKFPKKFWPEGAGREFFLYASTRRGYYGVWQEFE
KQYPDANVLLVTVTDEESRRIEQQPDSQTKAEIMEVVRCMFPDEDVPDATDILVPRWWSD
RFFRGSFSNWPIGVSRYEYDQLRAPVGRVYFTGEHTSERYNGYVHGAYLAGIDSAEILIN
CAQKKMCKYNVGGKHG
NT seq 1491 nt   +upstreamnt  +downstreamnt
atgacgaagcccacgacgatggccatttttcttgtcttagcgctatccatagcacagctt
cttccgtccctcgtcgctggcaccggccggccaagggtcatcattgttggcgctggcata
tccggtatctcagcggggaagcggatatgggaggctgggatagcagacgtattgatctta
gaggcgacagaccgcattggcgggcggatgcacaagcagagtttcgccggcgtcaatgtg
gagatcggtgccaactgggtggagggcgtcaatggcgaaaagaagaaccccatttggccc
atcgtcaactccaccctcaagctcagaagcttccgctccgactttgacagccttgcccag
aacgtctacaaggacggaggcctctgtgacgaagcatacgtgcagaagagaatggatcgg
gcagatgaagtggacaagagtggggagaatctctccgccacactgcacccaagcggccgg
gacgacatgtcaatcctttcaatgcaacggctcaacgatcacctacccaacggcccgtcg
tcgccggtggacatggcggtggactacttcacctacgactacgagttcgccgagccgccg
cgcgtgaccagcctgcagaacaccgttcccctccccaccttcaccgacttcggagacgac
acctacttcgtcgccgaccaacgtggctacgagtccgtcgtccaccacctcgccggccag
tacctcaacgccgacaagtccggcaacatcgccgacgcccgcctgaagctcaacaaggtg
gtgcgtgagatctcctactcctcgaccggcgtcaccgtgaagacggaggacaactcgacg
taccaggcagactatgtcatggtttctgcgagcttgggagtcctgcagagcgatctcata
cagttcaagccacagctgccttcttggaagattcttgcgatctaccaattcgacatggcc
gtgtacaccaagatattcgtcaagttccccaagaaattctggcccgaaggggcagggagg
gagttcttcctctacgcgagcaccaggagaggctactacggagtctggcaggagtttgag
aagcaatacccggatgccaatgtgctcctggtgacggtgaccgacgaggagtcgaggcgg
atcgagcagcagccggacagccagaccaaggcagagatcatggaggttgtgaggtgcatg
ttccctgacgaggatgtccccgacgccaccgacatcctcgtcccgagatggtggtccgac
aggttcttccggggcagcttctccaactggcccatcggcgtcagtcgctacgagtatgac
cagctcagggcgccggttgggagagtgtacttcaccggtgagcacacgagcgagcgctac
aatggctatgtccatggagcttatcttgcaggtattgactctgcagagattctgatcaac
tgtgcacagaagaagatgtgcaaatataatgtcgggggcaagcacggctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346882
Entry
4346882           CDS       T01015                                 
Name
(RefSeq) polyamine oxidase
  KO
K13366  polyamine oxidase [EC:1.5.3.14 1.5.3.16 1.5.3.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00330  Arginine and proline metabolism
osa00410  beta-Alanine metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    4346882
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    4346882
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.3  With oxygen as acceptor
    1.5.3.14  polyamine oxidase (propane-1,3-diamine-forming)
     4346882
    1.5.3.16  spermine oxidase
     4346882
    1.5.3.-
     4346882
SSDB
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox_3 Pyr_redox_2 NAD_binding_9 FAD_binding_2 Thi4 FAD_binding_3 GIDA FAD_oxidored HI0933_like
Other DBs
NCBI-GeneID: 4346882
NCBI-ProteinID: XP_015611432
LinkDB
Position
9:complement(12166534..12176992)
AA seq 490 aa
MTKPTTMAIFLSIVLLSMAQLPSLVAGTGRPRVIIIGAGISGISAGKRLSEAGITDILIL
EATDHIGGRMHKQRFAGVNVEIGANWVEGVNGEKMNPIWPIVNSTLKLRNFLSDFDSLAQ
NVYKDGGLCDAAYVQKRIDLADEADKSGENLSATLHPSGRDDMSILSMQRLNNHLPNGPS
SPVDMVVDYFTYDYEFAEPPRVTSLRNTVPLPTFTDFGDDNYFVADQRGYEAVVYYLAGQ
YLEADKSGNIVDARLQLNKVVREISYSSTGVTVKTEDNSTYQADYVMVSASLGVLQSDLI
QFKPQLPSWKILAIYQFDMAVYTKIFVKFPKKFWPEGAGREFFLYASTRRGYYGVWQEFE
KQYPDANVLLVTVTDEESRRIEQQPDSQTKAEIMEVVRSMFPDEDVPDATDILVPRWWSD
RFFQGSFSNWPIGVSRYEHDQLRAPVGRVYFTGEHTSERYNGYVHGAYLAGIDSAEILIN
CVCTEEYVQM
NT seq 1473 nt   +upstreamnt  +downstreamnt
atgacgaagcccacgacgatggccatttttctttctatagtgctactatccatggcacag
cttccctctctcgtcgccggcaccggccggccaagggtcataatcatcggcgccggcata
tccggtatttcagcggggaagcggctgtcggaggctgggataacggacatattgatctta
gaggcaacagaccacattggcgggcggatgcacaaacagaggtttgccggcgtcaatgtg
gagatcggcgccaattgggtggagggcgtcaatggtgagaagatgaaccccatttggccc
atcgtcaactccaccctcaagcttaggaacttcctctccgacttcgacagtcttgcccaa
aacgtctacaaggacggtggcctctgcgacgcagcatacgtgcagaagagaatcgacctg
gctgatgaagcggataagagtggggagaatctctccgccacactgcacccaagcggccgg
gacgacatgtcaatcctttcaatgcaacggctcaacaatcacctgcccaacggcccgtcg
tcgccggtggacatggtggtggactacttcacctacgactacgagttcgccgagccgccg
cgcgtgaccagcctgcggaacaccgttcccctcccgaccttcaccgacttcggagacgac
aactacttcgtcgccgaccaacggggctacgaggccgtcgtctactacctcgccggccaa
tacctcgaagccgacaagtccggcaacatcgttgacgctcgcctgcagctcaacaaggtg
gtgcgtgagatctcctactcctcgaccggcgtcaccgtgaagacggaggacaactcgacg
taccaggcagactatgtcatggtttctgcgagcttgggagtcctgcagagcgatctcata
cagttcaagccacagctgccttcttggaagattcttgcgatctaccaattcgacatggcc
gtgtacaccaagatattcgtcaagttccccaagaaattctggcccgaaggggcagggagg
gagttcttcctctacgcgagcaccaggagaggctactacggagtctggcaggagtttgag
aagcaatacccggatgccaatgtgctcctggtgacggtgaccgacgaggagtcgaggcgg
atcgagcagcagccggacagccagaccaaggcagagatcatggaggttgtgaggagcatg
ttccctgacgaggacgtccccgacgccaccgacatcctcgtcccgagatggtggtcggac
aggttcttccaaggcagcttctccaactggcccatcggcgtcagtcgctacgaacatgac
cagctcagggcgccggttgggagagtctatttcaccggtgagcacacgagcgagcgctac
aatggctatgtccatggagcttatcttgcaggtattgactctgcagaaattctgatcaac
tgtgtgtgtacagaagaatatgtgcaaatgtaa

DBGET integrated database retrieval system