KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327840
Entry
4327840           CDS       T01015                                 
Name
(RefSeq) vacuolar protein sorting-associated protein 28 homolog 1
  KO
K12184  ESCRT-I complex subunit VPS28
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4327840
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4327840
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4327840
Membrane trafficking [BR:osa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-I complex
    4327840
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4327840
  Exosomal proteins of other body fluids (saliva and urine)
   4327840
  Exosomal proteins of colorectal cancer cells
   4327840
  Exosomal proteins of bladder cancer cells
   4327840
SSDB
Motif
Pfam: VPS28
Other DBs
NCBI-GeneID: 4327840
NCBI-ProteinID: XP_015611162
UniProt: Q7F3E8 Q94DY4
LinkDB
Position
1:33089176..33090297
AA seq 213 aa
MEVKLWNDKRERELLESLADLYAIIKATEKLERAYVRDLVSAADYEAECLKLISQFNSLS
SSLAGVVTIPRFVEAYRLDCPAALNRLVQSGVPATVELRAAASSSAPASSAASAAAIAQC
VQSFITAMDAVKLNMLANDQVRPLLHDLSTSMGKLGPVLPPDFEGKVKVSEWLAKLNKMG
AGDELTEQQARQLNFDLDSAYSAFMASLPSTGL
NT seq 642 nt   +upstreamnt  +downstreamnt
atggaggtgaagctgtggaacgacaagcgggagcgggagctcctggagagcctcgccgac
ctgtacgccatcatcaaggcgacggagaagctggagcgcgcctacgtccgcgacctcgtc
tccgccgccgactacgaggccgagtgcctcaagctcatctcccagttcaactccctctcc
tcctcgctcgccggcgtcgtcaccatcccccggttcgtcgaggcctaccgcctcgactgc
cccgccgccctcaaccgcctcgttcagtccggcgtccccgccaccgtcgagctccgcgcc
gcggcgtcctcgtccgcgccggcctcctccgcggcgtccgcggccgccatcgcccagtgc
gtccagagctttattaccgccatggatgccgtcaagctcaacatgctcgccaacgaccag
gtccgccccttgctccacgacctctcgacctccatggggaagctgggccccgtcctgccg
ccggacttcgaagggaaggtcaaggtgagcgagtggctcgccaagctaaataagatgggg
gccggggatgagctcaccgagcaacaggcaaggcagctcaacttcgatctggattcggcg
tacagtgcgttcatggcatcactgcccagcaccggcctatga

DBGET integrated database retrieval system