KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327845
Entry
4327845           CDS       T01015                                 
Name
(RefSeq) sphingosine kinase 2 isoform X1
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00600  Sphingolipid metabolism
osa01100  Metabolic pathways
Module
osa_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    4327845
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     4327845
SSDB
Motif
Pfam: DAGK_cat YegS_C CERK_C
Other DBs
NCBI-GeneID: 4327845
NCBI-ProteinID: XP_015646404
UniProt: A0A0P0V8X5
LinkDB
Position
1:complement(33145902..33152652)
AA seq 521 aa
MGDHRATAKVRVNGAPAEATLFCTDPPGAANGGGGDGGELRWRCAGGAAAERVLSLDADV
LGVEARGKEVVVKAFVLPADAAARSVSCAAGAGKGGGGRRRRRRDYVFEMAAGEDAAAAW
CDRMRGSLDSLGRPKRLFILVNPFGGKKCGKKIYEAEIKPLFEAAGVNVTMQETRYQGHA
RQVASSLDLARYDGIVCVSGDGVLVEVVNGILQRMDWEEAMKIPIGVVPAGTGNGMAKSL
LHSASKTYSVPNAVFAIIRGYSQSLDVCTIVQGRKKFFSVLNMTWGLVADIDIESEKYRW
MGSARFDFYALVRIMNLRKYYGSIQYVPAPGYEAYGDVVKQVENCTVECQEQIGKSLCSY
QGPSVEFQGSEWRSLDGPFVSIWINNVQWAAESIMAAPGAKFSDGYMDAVIVRDCPKADL
LALLMKMGDGSHVKSPYVTYLKVRCLRLSPGQLVENPKRGGIIDVDGEAIARGEGTYGKN
QKQDVMGYGPSIQMTVHRALATMVASSILCLYWVFGYTCRM
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgggagaccaccgcgccacggccaaggtccgcgtgaacggcgcgccggcagaagcgacg
ctcttctgcaccgacccgccgggtgcagctaatggcggcggcggagatggaggggagctc
cggtggcggtgcgctggtggcgccgcggcggagcgcgtgctgtcgctggacgcggacgtg
ctcggggtcgaggccaggggtaaggaggtggtcgtgaaggccttcgtgctgccggcggac
gcggcggccaggtcggtgtcctgcgccgcgggtgcggggaagggaggaggaggacggagg
aggcgcaggagggattacgtgttcgagatggccgccggcgaggacgccgccgcggcctgg
tgcgacaggatgaggggctccctggactctctcggccggcctaagagattgttcatcctg
gtcaaccccttcggcggcaaaaaatgcggaaagaagatttacgaggcagagatcaagccc
ctgttcgaggccgccggtgtcaacgtcacaatgcaagagacccggtatcaggggcacgcc
cggcaggtggcgtcttctcttgaccttgcgcgctacgatggcattgtctgtgtcagcggc
gatggtgtcctcgtggaggtagtaaatggaattctacaacgaatggattgggaggaagcg
atgaagataccgattggggtggttccagcaggtacaggaaatggcatggctaaatcgctg
ttgcattctgccagtaagacatactcggttccaaatgccgtatttgccattatcagaggt
tacagtcagtccttggatgtatgcaccattgtgcagggaaggaagaaatttttcagtgtc
ttgaatatgacttggggtttggtggctgatatagatattgagtctgagaagtacaggtgg
atgggaagtgcacgctttgatttctatgctttggttcgcataatgaacttgagaaaatac
tacggaagtattcagtatgttcctgcccccggctatgaggcatatggagatgtcgtcaag
caggttgagaattgcactgtagaatgccaagaacagattgggaagtctttgtgttcttat
caaggtccttccgttgagtttcaaggttcagaatggagatcccttgatggtccatttgtg
tctatttggatcaacaacgtgcaatgggctgctgagagtatcatggcagctcctggggcc
aagttctcagatggctacatggatgcagtcatagtcagggactgtccaaaggctgatctt
ttagccctactgatgaagatgggcgatgggagtcatgtaaaatcaccatacgttacgtat
ctaaaggtgagatgtcttcggttatcaccaggccagcttgtggagaatccaaaacgaggt
ggcataatagacgtggacggggaggctatcgctagaggagaaggaacgtacggcaaaaac
cagaaacaggacgtgatgggttatggcccttccattcagatgacagtgcaccgagcgttg
gccacaatggtagcttcgtctattttgtgtttgtattgggtatttgggtatacatgtagg
atgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343607
Entry
4343607           CDS       T01015                                 
Name
(RefSeq) sphingosine kinase 1
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00600  Sphingolipid metabolism
osa01100  Metabolic pathways
Module
osa_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    4343607
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     4343607
SSDB
Motif
Pfam: DAGK_cat YegS_C CERK_C MLTR_LBD
Other DBs
NCBI-GeneID: 4343607
NCBI-ProteinID: XP_015647921
LinkDB
Position
7:22513069..22518721
AA seq 513 aa
MAEEQSKAQAGAKALSEPVRVGGSAAEATLSGGELAWRPTGGGGGGGEAGRLELESEVLG
VRVDGRALRVATFARGDDAAAAAARPATCGGGERRREREREREVVVEMESEEAAAAWGDA
MRDRLASLGRPKRLFIIVNPYGGKRGGRKIFQTEVLPLIEAAGILYTMQETKHRLHAQEI
AHSLDLRKYDGIVCVSGDGVLVEVVNGLLQREDWNTAIKIPLGIIPAGTGNGMVQSLVHF
AGESFSVYNAVLAIIRGHKRPLDVTSVVQGKTRFFSVLMLTWGLVADIDIESEKYRWMGS
ARLDFYSLLRVVSLRRYNGRVLFVPAPGYEGLGDLVEQISSCKSNGASTGVQEDRSNDFN
DETCAYAGPSIDETDHEWRSLDGPFVSVWVSGVPFASENVMTAPEAKFGDGYLDVAIIKD
CPRSALAGLMFQMKDGSYVKSPYVEYFKVKALRIEPGMRVGSTTKGGIIDSDGEVIARGD
GSHTGDEIEHLMAYGPPIQLTVDQGLATIFSPR
NT seq 1542 nt   +upstreamnt  +downstreamnt
atggcggaggagcagtccaaggcccaggcgggggcgaaggccctgtcggagccggtgcgg
gtcggggggtccgcggcggaggccacgctctccggcggggagctggcgtggcgccccacg
ggaggcggcgggggaggaggggaggcggggaggctggagctggagtccgaggtgctcggg
gtccgggtggacgggagggcgctcagggtcgcgaccttcgcgaggggcgacgacgcggcg
gcggcggcggcgcggccggcgacgtgcgggggcggggagaggaggagggagagggagagg
gagagggaggtggtggtggagatggagagcgaggaggccgccgcggcgtggggggacgcc
atgagagatcgcctcgcctcgcttggtcggccaaagagattgttcatcatagttaaccct
tatggtggaaagagaggtgggcggaagattttccagactgaggtcctacctctcattgaa
gctgctggcatcctttacaccatgcaagaaaccaagcatcggcttcacgctcaagaaatt
gctcattcactggatcttaggaaatatgatggaattgtttgcgtcagtggagatggtgta
cttgtagaggtggttaatggtctgctgcaaagagaggactggaacacagcaataaaaata
ccattaggcatcatcccggcaggtaccggaaatggaatggtgcaatcacttgtgcatttt
gctggtgaatccttctccgtttataacgctgtgcttgcaattatcagaggtcacaagcgt
ccccttgatgttacctctgttgtgcagggaaagacaaggttttttagtgtcttgatgctt
acttggggtctggtagctgatatcgatattgagtcagagaagtacaggtggatgggcagt
gctcgtcttgacttctattcccttctccgtgtggtgagcttgcggcggtacaatgggcgt
gttctttttgttccagccccaggatacgaaggacttggtgatcttgtagagcaaattagc
agttgcaaatcaaatggggctagcactggtgtacaagaggacagatcaaatgattttaat
gacgaaacatgtgcttacgcaggcccttcaattgatgaaactgatcatgagtggagatca
ctggatggcccatttgtttcggtttgggtcagtggtgttccttttgctagtgaaaatgtc
atgacagcaccagaagcaaagtttggagatggctacttggatgtagccataatcaaggac
tgccctaggtcggctcttgctgggctgatgtttcagatgaaggatggcagctatgtcaaa
tccccctatgtggagtacttcaaggtgaaggctctcaggattgagccgggaatgcgggtg
ggcagcaccaccaagggcggcatcatcgactccgatggcgaggtgatcgcgagaggggat
ggatcacacactggcgacgagatagagcacctgatggcctatggccctcccatccaactg
acggtggatcagggcttggccaccattttctcccctagatga

DBGET integrated database retrieval system