KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327870
Entry
4327870           CDS       T01015                                 
Name
(RefSeq) 8-amino-7-oxononanoate synthase isoform X1
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00780  Biotin metabolism
osa01100  Metabolic pathways
osa01240  Biosynthesis of cofactors
Module
osa_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    4327870
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4327870
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     4327870
Amino acid related enzymes [BR:osa01007]
 Aminotransferase (transaminase)
  Class II
   4327870
SSDB
Motif
Pfam: Aminotran_1_2 Aminotran_5 Cys_Met_Meta_PP MGC-24
Other DBs
NCBI-GeneID: 4327870
NCBI-ProteinID: XP_015632906
UniProt: Q5JL51
LinkDB
Position
1:30712401..30717688
AA seq 450 aa
MAQWDALVDAALARLASRNLLRATRPIALAPPPAPPETFAGPGPWDRAAVEIQLDRATLH
QWLAEGGEATGQEEEVDEKLILFSGNDYMGLSSHPAIRKAAVKAAQEYGMGPRGSALICG
YTTYHKLVEESLAELKKKEDCLLCPTGFSANMAVMTALGSVSSILSVGRKPAEGERIAVF
SDALNHASIIDGIRLVERQQEVVAFVYKHCDMHHLDFLLSSCSIEKKVVVTDSLFSMDGD
FAPLPELVKLRRKYGFLLVIDDAHGTLVCGENGGGAPELFGCENDIDISVGTLSKAAGCQ
GGFIVCSNRWKRLIQSRGRSFIFSTALPVPVVASVYAALHVSKKERWRRSVIWRHVQYFA
SLTKLDLTSPIISIVVGSEEAALRAGRHMLRSGFHVTPIRPPTVPQNSCRLRITLSASHS
LDDIKRLVDALSPWLPDKHDEQTYVMASKL
NT seq 1353 nt   +upstreamnt  +downstreamnt
atggcacagtgggacgcgctcgtggacgccgcgcttgcaaggctggcgtcgaggaacctc
ctgcgagccacgcgtcccatcgccctcgcgccacctccagcgccgcctgaaaccttcgcc
ggccctggcccatgggaccgcgccgccgtcgagatccagctcgatcgcgcaaccctccac
caatggctcgccgaaggtggtgaagcgactggccaagaagaggaggtggatgagaaactc
attctattctccgggaatgattacatgggcctcagctcccatccggcaatccgcaaggct
gcagtgaaggcagctcaagagtacggcatgggacctaggggctctgccttgatatgtggc
tatactacttatcacaaattggtggaggaatctttggcagagttgaagaaaaaggaggat
tgccttctttgcccaacaggattttctgccaacatggctgtgatgactgctctgggaagt
gtgagctctattttgtctgttgggagaaaacctgcagagggtgagagaattgcagttttc
tcggatgctctcaaccatgcttctatcattgatggaattcgccttgttgagcgacagcaa
gaagtagtagcatttgtctacaagcactgtgacatgcatcatcttgatttcctactgtcc
agttgctcaattgaaaagaaagttgttgtcacagatagcctgtttagcatggatggtgat
tttgctccattaccagaacttgtcaaattacgcagaaagtatgggtttttgttggtcatc
gacgatgcacatggaacacttgtttgtggcgagaatggtggtggtgcacccgagctgttt
ggatgcgaaaatgacattgacataagcgttggtaccctaagtaaggctgctggctgccag
ggtggttttatagtttgcagcaaccgatggaagaggctaattcaatcgcgtggccgctca
ttcatattttcaactgctttgccagttccagtagttgcctctgtgtatgctgctctccat
gtctcaaagaaggagagatggcggagatcagtgatctggaggcatgtgcagtattttgct
tctttgaccaaactcgacttaactagtcccataatttccatagtagttggaagcgaagaa
gcagcacttagggctggcaggcatatgctaagatctggatttcatgttacaccaattcga
ccacccacagtaccacaaaactcgtgcaggttgcgaataactctaagcgcttctcattcc
ttggatgacatcaaaaggctggtagatgcactatcaccctggcttcctgacaaacatgat
gagcagacatatgttatggcgtcaaaactttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349380
Entry
4349380           CDS       T01015                                 
Name
(RefSeq) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00780  Biotin metabolism
osa01100  Metabolic pathways
osa01240  Biosynthesis of cofactors
Module
osa_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    4349380
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4349380
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     4349380
Amino acid related enzymes [BR:osa01007]
 Aminotransferase (transaminase)
  Class II
   4349380
SSDB
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP Aminotran_5
Other DBs
NCBI-GeneID: 4349380
NCBI-ProteinID: XP_015613014
UniProt: Q7XC62 Q0IVP7
LinkDB
Position
10:22105208..22109115
AA seq 450 aa
MAQWDALVDAALARLASRSLLRATRPIALAPPPAPPETFPCPGPWDRAAVEIRLDRATLH
QWLAEGGEGSGQEEKVDEKLILFSGNDYMGLSSHPAIRHAAVKAAEEYGMGPRGSALICG
YTTYHKMVEESLAELKKKEDCLLCPTGFSANMAVMTALGNISSLLAAGRKPAEDERIAIF
SDALNHASIIDGIRLVERQQEVVSFVYKHCDMSHLELLLSSCSMEKKVVVTDSLFSMDGD
FAPLPELVKLRRKYGFLLVIDDAHGTLVCGENGGGAPELFECENEIDISVGTLSKAAGCQ
GGFIACSTRWKRLIQSRGRSFIFSTALPVPVVASVYAALYVSREERWRRSVIWRHVQYFA
SLTKLNITSPIISIVVGSEKAALRAGRDMLRSGFHVTPIRPPTVPPNSCRLRITLSASHS
SDDIKRLVDALTPWLPHKHDIQIYAVASKL
NT seq 1353 nt   +upstreamnt  +downstreamnt
atggcgcagtgggacgcgctcgtggacgccgcgctggcgaggctggcgtccaggagcctc
ctgcgcgccacgcgccccatcgccctcgcgccgccgcccgcgccgccggagaccttcccc
tgcccaggcccgtgggaccgcgcagccgtcgagatccggctcgaccgcgcaacgctccac
caatggctggctgaaggtggtgaggggagtggccaagaagagaaagtggacgagaaactg
attcttttctccgggaatgattacatgggcctcagctcgcatcctgcaattcgccatgcc
gcagtgaaggcagctgaagagtacggcatgggccctagaggatctgcgttgatttgtgga
tatactacctatcacaaaatggtggaggaatcgttggcagagctgaagaaaaaggaggat
tgccttctttgtcccactggattttctgccaatatggctgtaatgacggctctgggaaac
atcagctctctgttggctgctgggagaaaacctgcggaggacgaaagaatagcaattttc
tcagatgctctgaaccatgcttcgatcattgatgggattcgccttgttgagcgacagcaa
gaagtggtatcatttgtgtacaagcactgtgacatgtcccatcttgaacttttgctatcc
agttgctcaatggaaaagaaagttgttgtcacagatagcctgttcagcatggatggtgat
tttgctccattgcctgagcttgtcaagttgcgcagaaagtatgggtttttgttggtgatc
gacgatgcacatggaacacttgtttgtggtgagaatggtggtggtgcacctgagctgttt
gaatgtgagaatgagattgacataagtgttggcaccttaagcaaggctgctggctgccag
ggtggttttatagcatgcagtacccgatggaagaggctgattcaatcgcgaggtcgttcc
ttcatattttcaactgctttaccagtgccagtagttgcttctgtgtatgctgccctctat
gtatcaagggaggagagatggcggagatcagtgatctggaggcatgtgcagtattttgcc
tctttgacaaaactcaacataacaagtcccataatttccattgtagttggaagtgaaaaa
gcagcacttagagctggaagggatatgctaagatctggatttcatgtcacgccaatccga
ccacccacagtaccgcccaactcatgcaggttgcgaataactctcagtgcttctcattct
tcggatgacatcaaaaggctggtggatgcgctgacgccgtggctccctcacaaacatgat
attcagatatatgctgtggcatcaaagctctaa

DBGET integrated database retrieval system