KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327880
Entry
4327880           CDS       T01015                                 
Name
(RefSeq) protein farnesyltransferase subunit beta isoform X1
  KO
K05954  protein farnesyltransferase subunit beta [EC:2.5.1.58]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00900  Terpenoid backbone biosynthesis
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    4327880
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:osa01006]
    4327880
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.58  protein farnesyltransferase
     4327880
Prenyltransferases [BR:osa01006]
 Protein prenylation
  Farnesyltransferase/geranylgeranyltransferase 1
   4327880
SSDB
Motif
Pfam: Prenyltrans SQHop_cyclase_N
Other DBs
NCBI-GeneID: 4327880
NCBI-ProteinID: XP_015642051
UniProt: Q0JJI1 A0A0P0V7Y8
LinkDB
Position
1:complement(30775116..30779337)
AA seq 478 aa
MVRRLSVRSPRLQRARRPPPSAPPTTAPMDPPSPPPPPPYPPAAAEGGPAADSQAAELPR
LTVTQVEQMKVEAKVGEIYRVLFGNAPNANSLMLELWREQHVEYLTRGLKHLGPSFHVLD
ANRPWLCYWIIHALALLDEIPDDVEDDIVDFLSRCQDKDGGYGGGPGQLPHLATTYAAVN
TLVTIGSERALSSVNRDNLYKFMLRMKDTSGAFRMHDGGEIDVRASYTAISVASLVNILD
GELAKGVGNYITRCQTYEGGIAGEPYAEAHGGYTFCGLATMILLNEVDKLDLASLIGWVA
FRQGVECGFQGRTNKLVDGCYSFWQGAALALTQKLMTVVDEQLKSSYSSKRPPGDDACGT
SSSTEAAYYAKFGFDFIEKSNQIGPLFHNIALQQYILLCAQVLDGGLRDKPGKNRDHYHS
CYCLSGLSVSQYSAMVDSDACPLPQHVLGPYSNLLEPIHPLYNVVLDKYHTAYEFFSS
NT seq 1437 nt   +upstreamnt  +downstreamnt
atggttcgccgcctttcggtgagatccccgcggctgcagcgagctcgcaggccgccgcct
tccgcgccgccgaccaccgcgcccatggaccccccctcgccgccgccgccgccgccatat
cctcctgctgctgctgagggcggtccggcagcggatagccaggccgctgagctgccccgg
ctgactgtgacgcaggtggagcagatgaaggtggaggcgaaggtgggcgaaatctaccgc
gtcctcttcggcaacgcgcccaacgccaattccctcatgttagagctgtggcgtgagcag
catgttgagtatttgacgagagggctgaaacatcttggaccaagcttccatgtgctcgat
gccaatcgaccttggctgtgctactggattattcatgcacttgctctgttggatgaaata
cctgacgatgttgaggatgatattgtggacttcttatctcgatgtcaggacaaagatggt
ggttatggcggaggacctggacagttgcctcatctcgctacaacttatgctgctgtaaat
acacttgtaactatagggagtgaaagggcactatcatcggtaaacagggacaacctgtac
aagttcatgcttcggatgaaagatacatcgggagctttcagaatgcatgatggtggtgaa
atagatgttcgtgctagctatactgcaatatcggttgccagccttgtgaacattcttgat
ggtgaactagcaaaaggtgttggaaattacataacaaggtgtcaaacctatgaaggtggc
attgctggggaaccgtatgctgaagctcatggtgggtacactttttgtgggctggctacg
atgatcctgcttaacgaagtggacaaacttgatttggctagcttgattggctgggtggca
tttcgccaaggagtggaatgtggatttcaaggacgaactaataaattggttgatggttgc
tactccttttggcagggagctgctcttgctttaacacaaaaactaatgacagttgttgat
gagcaattaaaatcatcatattccagcaaaaggcctccaggagatgatgcttgtggtacg
agctcttctactgaagcagcatattatgctaagtttggatttgattttatagagaagagc
aaccaaataggcccactgttccacaacatcgcgctgcagcaatacatcctgctttgcgca
caggtgctggatggagggttgagggataagcctgggaagaacagagatcactaccactcg
tgctactgcctgagtggtctgtcagttagccagtacagcgccatggttgattctgatgcg
tgccccttgccgcagcacgtgcttggtccttactcaaacttgctagagccgatccatccg
ctctacaatgttgtactagacaaataccatacggcctatgagttcttttcaagctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347566
Entry
4347566           CDS       T01015                                 
Name
(RefSeq) protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha
  KO
K05955  protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha [EC:2.5.1.58 2.5.1.59]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00900  Terpenoid backbone biosynthesis
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    4347566
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:osa01006]
    4347566
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.58  protein farnesyltransferase
     4347566
    2.5.1.59  protein geranylgeranyltransferase type I
     4347566
Prenyltransferases [BR:osa01006]
 Protein prenylation
  Farnesyltransferase/geranylgeranyltransferase 1
   4347566
SSDB
Motif
Pfam: PPTA
Other DBs
NCBI-GeneID: 4347566
NCBI-ProteinID: XP_015612455
UniProt: A0A0P0XQI9 Q69IM7
LinkDB
Position
9:20023942..20027132
AA seq 339 aa
MAPSSTSSEGASDEWLPPSRRPELADVVPVTQDDGPHPVVAIAYRDEFREVMDYFRALYF
AGERSVRALHLTAEVIDLNPGNYTVWHFRRLVLEALDADLREEMDFVDRIAECNPKNYQI
WHHKRWLAEKLGPDIANKEHEFTRKILSMDAKNYHAWSHRQWVLQALGGWETELQYCNQL
LEEDVFNNSAWNQRYLVITSSPLLGGLAAMRDSEVDYTVGAILANPQNESPWRYLKGLYK
GENNLLMADERISDVCLKVLKHDSTCVFALSLLLDLLQIGLQPSDELKGTIEAIKNSDPE
ADEAVDADLATAICSILQRCDPLRINYWSWYRTTISSQT
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggcgccgtcgtcgacgtcgtcggagggtgcctccgacgagtggttgccacccagccgg
cggccggagctggcggacgtggtccccgtgacgcaggacgacgggccccaccccgtggtg
gccatcgcctaccgggacgagttccgcgaggtcatggactacttccgcgccctctacttc
gccggcgagcgcagcgtccgcgccctccacctcaccgccgaggtcatcgaccttaatccc
ggcaactacacggtgtggcattttaggcgtcttgttctagaggcactggatgctgatctg
cgtgaggaaatggattttgtggaccgaattgctgaatgtaacccaaaaaattatcaaatc
tggcatcacaagagatggcttgcggagaaattaggaccagatattgcaaataaagagcac
gaatttacaaggaagatactttctatggatgctaaaaattaccatgcttggtctcatagg
cagtgggttcttcaagcactgggtggatgggagactgaactacagtattgcaaccagctg
cttgaggaagacgtcttcaataattcagcttggaatcagagataccttgtaataacaagt
tcaccacttcttggaggccttgcagcaatgcgtgactcggaagtggattacacagttggg
gctattctggctaaccctcagaatgaaagcccctggagatacctcaaaggcctgtacaag
ggtgaaaataacttgctgatggctgatgagcgcatctctgatgtttgtctcaaggtcctg
aaacatgattcgacctgcgtatttgctttgagcttgctgctcgatcttcttcaaattggt
ttacaaccttcagatgaactcaaaggaactatcgaagcaataaagaactctgatcctgaa
gcagatgaagcagtagatgctgatcttgcgactgcaatctgctcaatattgcagagatgt
gatcccctgcggataaattactggtcctggtacaggaccactatttcttctcaaacctga

DBGET integrated database retrieval system