KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327908
Entry
4327908           CDS       T01015                                 
Name
(RefSeq) cinnamoyl-CoA reductase 1
  KO
K09753  cinnamoyl-CoA reductase [EC:1.2.1.44]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00940  Phenylpropanoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00039  Monolignol biosynthesis, phenylalanine/tyrosine => monolignol
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    4327908
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.44  cinnamoyl-CoA reductase
     4327908
SSDB
Motif
Pfam: Epimerase 3Beta_HSD NAD_binding_10 NAD_binding_4 GDP_Man_Dehyd NmrA Polysacc_synt_2 adh_short KR Sacchrp_dh_NADP
Other DBs
NCBI-GeneID: 4327908
NCBI-ProteinID: XP_015643435
UniProt: Q7F721
LinkDB
Position
1:10144266..10146480
AA seq 326 aa
MVTGVEQMVCVTGAGGFIGSWLVKELLHRGYAVRAAVRDPEGRKNAHLHALERAKRRLSL
HRADVLDCNSLRAAFNLCDGVFHVASPVSDDPELLPTAIEGTKNVINAAADMGIKRVVFT
SSYGAAHMNPNRRSDQTLDETCWSDLEFCKQTQNWYCYAKTVAEKTATEEASKRGVQLLV
VVPAVTVGEMLQPTLNASVYRVATYMRGTKSAYPNAVAAYVDVRDVARAHALVYEHPDAR
GRYLCIGSVLHRSEFVRLLRELFPQYPITTRCEDNSKPMVKPYQFSVQRLEALGMQFTPL
KESLYKTVISLQDKGHLPAISPRSAL
NT seq 981 nt   +upstreamnt  +downstreamnt
atggtcaccggcgtcgagcagatggtgtgcgtgaccggcgccggtggcttcatcgggtca
tggctggtgaaggagctcctccaccgcggatacgccgtgagggcagccgtgagagaccct
gagggcagaaagaatgctcatttgcatgctctggagagagctaaaagaaggttgtccctc
cacagagctgatgtgttggactgcaacagccttcgtgctgcgttcaacttatgcgatggt
gttttccacgtggcatcaccagtctcagatgaccctgaacttctgccaactgctatcgag
ggaacaaagaatgtcatcaatgctgctgcggacatgggcatcaagcgtgtggtgtttact
tcgtcttatggtgctgcccatatgaaccctaacaggagatcagatcagactcttgatgag
acttgttggagtgaccttgagttctgcaaacaaacacagaattggtactgctacgcgaag
acggtggccgagaagacggcgacggaggaggcgtcgaagagaggtgtgcagctgttggtg
gtggtgcctgccgtcaccgtgggggagatgctgcagccgacgctgaacgccagcgtctac
agggtggccacctacatgaggggcaccaagagtgcgtacccgaacgccgtcgccgcgtac
gtcgacgtgcgcgacgtcgcccgcgcgcacgcgctggtgtacgagcaccccgacgcgcgt
ggccgctacctctgcatcggcagcgtgctgcaccggtccgagtttgttcgcttgcttagg
gagctcttcccccagtaccctatcaccaccaggtgtgaggacaacagtaagccaatggtg
aaaccttaccaattctctgtacaaaggctggaggctttaggcatgcagttcactcctttg
aaagagagcttgtacaagacagtgataagcttacaggacaagggtcacctaccagcaatc
tcacctcgttcagccctgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327909
Entry
4327909           CDS       T01015                                 
Name
(RefSeq) cinnamoyl-CoA reductase 1
  KO
K09753  cinnamoyl-CoA reductase [EC:1.2.1.44]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00940  Phenylpropanoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00039  Monolignol biosynthesis, phenylalanine/tyrosine => monolignol
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    4327909
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.44  cinnamoyl-CoA reductase
     4327909
SSDB
Motif
Pfam: Epimerase 3Beta_HSD NAD_binding_10 GDP_Man_Dehyd NAD_binding_4 NmrA Polysacc_synt_2 adh_short KR Sacchrp_dh_NADP
Other DBs
NCBI-GeneID: 4327909
NCBI-ProteinID: XP_015642324
UniProt: A0A0P0V1S5 Q9AQV6
LinkDB
Position
1:10148682..10152526
AA seq 328 aa
MVTGRSEQMVCVTGAGGFIGSWLVKELLHRGYFVRGAMREPADIKNAHLHVLDGAREGLS
LYRADVLDRNSLRAAFALCDGVFHVASPVSNDPELLPAAIEGTKNVINAAADMGVKRVVF
TSSYGAVHMNPNRRSDQIVDESCWSDLEFCKQTQNWYCYAKMLAERTAMEEASKRGVNLL
VVVPAVTVGEMLQPTLNASVHRVATYMRGTKSAYPNAVAAYVDVRDVARAHALVYEHPDA
RGRYLCIGSVLHRSEFVRLLRELFPQYPITSRCKDNSKPMVKPYKFSVQRLETLGMQFTP
LKESLYRTVISLQDKGHLPAAISRRSAL
NT seq 987 nt   +upstreamnt  +downstreamnt
atggtcaccggccggagcgagcagatggtgtgcgtgaccggcgccggtggcttcatcggg
tcgtggctggtgaaggagctcctccaccgcggatacttcgtgaggggagccatgagagaa
cctgcggacatcaagaatgctcatttgcatgttctggatggagctagagaaggcctgtcc
ctctaccgagctgatgtgctcgaccgcaacagccttcgtgctgcgttcgccttatgcgat
ggcgttttccacgtggcatcgccagtctcaaatgaccctgaacttctgccagctgctatc
gagggaaccaagaatgtcatcaacgctgctgcggacatgggcgtcaagcgtgtggtgttt
acttcgtcttatggtgctgtccatatgaaccctaacagaagatctgaccagattgttgat
gagagctgttggagtgaccttgagttctgcaaacaaacacagaactggtattgctacgcg
aagatgttggccgagaggacggcgatggaggaggcgtcgaagagaggtgtgaatctgttg
gtggtcgtgccggccgtcaccgtgggggagatgctgcagccgacgctgaacgccagcgtc
cacagggtggccacctacatgaggggcaccaagagtgcgtacccgaacgccgtcgccgcg
tacgtcgacgtgcgcgacgtcgcccgcgcgcacgcgctggtgtacgagcaccccgacgcg
cgtggccgctacctctgcatcggcagcgtgctgcaccggtccgagtttgttcgcttgctt
agggagctcttcccccagtaccctatcacctccagatgtaaggacaacagtaagccaatg
gtgaaaccatacaaattctctgtacaaaggctggagactttaggcatgcagttcactcct
ttgaaagagagtttatacagaacggtaataagcttacaagacaagggtcatctacctgca
gcaatctcacgccgttcagccctgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328509
Entry
4328509           CDS       T01015                                 
Name
(RefSeq) cinnamoyl-CoA reductase 2
  KO
K09753  cinnamoyl-CoA reductase [EC:1.2.1.44]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00940  Phenylpropanoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00039  Monolignol biosynthesis, phenylalanine/tyrosine => monolignol
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    4328509
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.44  cinnamoyl-CoA reductase
     4328509
SSDB
Motif
Pfam: Epimerase NAD_binding_10 3Beta_HSD GDP_Man_Dehyd NmrA NAD_binding_4 Polysacc_synt_2 adh_short KR PadR TrmB RmlD_sub_bind
Other DBs
NCBI-GeneID: 4328509
NCBI-ProteinID: XP_015625865
UniProt: A0A0P0VFL4 Q6H817
LinkDB
Position
2:4497082..4500181
AA seq 344 aa
MAAAVVCVTGAGGFIGSWIVKLLLARGYAVRGTSRRADDPKNAHLWALDGAAERLTMVSV
DLLDRGSLRAAFAGCHGVIHTASPMHDDPEEIIEPVITGTLNVVEVAADAGVRRVVLSST
IGTMYMDPRRDPDSPLDDSFWSDLDYCKNTKNWYCYAKTIAERKAWEVARGRGVDMAVVI
PVVVLGELLQPGMNTSTKHILKYLTGEAKTYVNESHAYVHVVDAAEAHVRVLEAPGAGGR
RYICAERTLHRGELCRILAGLFPEYPIPTRCRDEINPPKKGYKFTNQPLKDLGIKFTPVH
EYLYEAVKSLEDKGFIKKTSNTKELHRQSSPPQNSPASMLMSKL
NT seq 1035 nt   +upstreamnt  +downstreamnt
atggccgccgccgtcgtctgcgtcaccggcgccggcgggttcatcgggtcgtggatcgtc
aagctcctcctcgcccgcggctacgccgtccgcggcacatcccgccgcgccgatgacccg
aagaacgcgcacctgtgggcgctcgacggcgcggcagagcggctgacgatggtgagcgtc
gacctgctcgaccgtggcagcctccgcgccgccttcgccggctgccacggcgtcatccac
accgcctcgccgatgcacgacgacccggaggagatcatcgagccggtgatcaccgggacg
ctgaacgtggtggaggtggccgccgacgccggcgtgcggcgggtggtgctctcctccacc
atcggcaccatgtacatggaccctcgccgcgaccccgactcccccctcgacgactccttc
tggagcgatctcgactactgcaagaacaccaagaattggtattgctacgcgaagacgata
gcggagaggaaggcgtgggaggtggcgaggggtcggggggtggacatggcggtggtgatc
ccggtggtggtgctcggcgagctgctgcagccagggatgaacaccagcaccaagcacatt
ctcaagtacctcaccggcgaggccaagacgtacgtcaacgagtcccacgcctacgtgcac
gtcgtggacgccgccgaggcccacgtcagggtgctggaggcgccgggggccggcggacgc
cggtacatctgcgccgagcgcaccctgcaccgcggcgagctctgccggatcctcgccggc
ctcttcccggagtatccgatccctacaaggtgcagggatgagataaatccaccaaagaag
ggctacaagttcacaaaccaacctctgaaggatctaggcatcaagttcacacctgtgcat
gaatacctgtatgaagcagtgaagtccctggaagacaaaggattcatcaagaagacctcc
aataccaaggagcttcacaggcaaagttctccccctcaaaattcacccgcgagcatgctg
atgtcgaagctttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331085
Entry
4331085           CDS       T01015                                 
Name
(RefSeq) cinnamoyl-CoA reductase 2
  KO
K09753  cinnamoyl-CoA reductase [EC:1.2.1.44]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00940  Phenylpropanoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00039  Monolignol biosynthesis, phenylalanine/tyrosine => monolignol
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    4331085
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.44  cinnamoyl-CoA reductase
     4331085
SSDB
Motif
Pfam: Epimerase 3Beta_HSD NAD_binding_10 GDP_Man_Dehyd NAD_binding_4 NmrA Polysacc_synt_2 KR adh_short AP_endonuc_2
Other DBs
NCBI-GeneID: 4331085
NCBI-ProteinID: XP_015622902
UniProt: Q6K9A2
LinkDB
Position
2:complement(34564285..34566280)
AA seq 338 aa
MSSNFEANNNNNGEKQLVCVTGAGGFIGSWVVKELLIRGYHVRGTARDPADSKNAHLLEL
EGADERLSLCRADVLDAASLRAAFSGCHGVFHVASPVSNDPDLVPVAVEGTRNVINAAAD
MGVRRVVFTSSYGAVHMNPNRSPDAVLDETCWSDYEFCKQTDNLYCCAKMMAEMTATEEA
AKRGLELAVVVPSMTMGPMLQQTLNFSTNHVARYLMGTKKSYPNAVAAYVDVRDVARAHV
LVYERPEARGRYLCIGTVLHRAELLRMLRELFPRYPATAKCEDDGKPMAKPYKFSNQRLK
DLGLEFTPLRKSLNEAVLCMQQKGHLPLIYPVPKRAYL
NT seq 1017 nt   +upstreamnt  +downstreamnt
atgtcgtccaattttgaggccaacaacaacaacaatggcgagaagcagctggtctgtgtg
accggagcaggtggcttcattgggtcgtgggtggtgaaggagctcctcatccgtggctac
cacgtcaggggaacagccagggatcctgctgacagcaagaatgctcacctgcttgagctg
gagggagccgacgagaggctctccctctgccgcgccgacgtcctcgacgccgccagcctc
cgcgccgccttcagcgggtgccacggcgtcttccatgtcgcctccccggtgtctaacgac
cctgaccttgttccggttgcagtggaggggacgaggaacgtgatcaacgcagcggcggac
atgggcgtgcgccgcgtggtgttcacgtcgtcgtacggcgccgtgcacatgaaccccaac
cggagccccgacgccgtcctcgacgagacctgctggagcgactacgaattctgcaagcaa
acagacaacctgtactgctgcgccaagatgatggcggagatgacggcgacggaggaggcg
gcgaagagggggctggagctggcggtggtggtgccgtcgatgacgatgggtcccatgctt
cagcagacgctcaacttcagcaccaaccacgtcgcccgctacctcatgggcaccaagaag
tcctaccccaacgccgtcgcggcctacgtcgacgtccgcgacgtcgcccgcgcacacgtc
ctcgtctacgagcgccccgaggcacgcggccgctacctctgcatcggcaccgtgctccac
cgcgccgagctcctccggatgctcagggagctcttcccacggtaccctgccactgcaaag
tgtgaggatgatgggaagccgatggcgaagccgtataagttctcgaaccagaggctcaag
gatttgggtttggagttcactccactgaggaagagtttgaatgaggcggtcctatgcatg
cagcagaagggtcacctgcctctgatttatcccgttccaaaacgtgcttacctataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331101
Entry
4331101           CDS       T01015                                 
Name
(RefSeq) cinnamoyl-CoA reductase 1
  KO
K09753  cinnamoyl-CoA reductase [EC:1.2.1.44]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00940  Phenylpropanoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00039  Monolignol biosynthesis, phenylalanine/tyrosine => monolignol
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    4331101
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.44  cinnamoyl-CoA reductase
     4331101
SSDB
Motif
Pfam: Epimerase 3Beta_HSD NAD_binding_10 GDP_Man_Dehyd NAD_binding_4 NmrA Polysacc_synt_2 KR adh_short
Other DBs
NCBI-GeneID: 4331101
NCBI-ProteinID: XP_015624761
UniProt: A3ACJ9 Q6K5W5
LinkDB
Position
2:34742450..34744247
AA seq 337 aa
MSSNFEANNNNGEKQLVCVTGAGGFIGSWVVKELLIRGYHVRGTARDPADSKNAHLLELE
GADQRLSLCRADVLDAASLRAAFSGCHGVFHVASPVSNDPDLVPVAVEGTRNVINAAADM
GVRRVVFTSSYGAVHMNPSRSPDAVLDETCWSDYEFCRQTDNLYCCAKMMAEMTATEEAA
KRGLELAVVVPSMTMGPMLQQTLNFSSNHVARYLMGTKKSYPNAVAAYVDVRDVARAHVL
VYERPDARGRYLCIGTVLHRAELLRMLRDLFPQYPATAKCEDDGKPMAKPYKFSNQRLKD
LGLEFTPLRKSLHEAVLCMQQKSHLPLIYPVPKRAYL
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgtcgtccaattttgaggccaacaacaacaatggcgagaagcagctggtctgtgtgacc
ggagcaggtggcttcattgggtcgtgggtggtgaaggagctcctcatccgtggctaccac
gtcaggggaacagccagagatcctgctgacagcaagaatgctcacctgcttgagctggag
ggagccgaccagaggctctccctctgccgtgccgacgtcctcgacgccgccagcctccgc
gccgccttcagcgggtgccacggcgtcttccatgtcgcctccccggtgtccaacgaccct
gacctggttccggttgcagtggaggggacgaggaacgtgatcaacgcggcggcggacatg
ggcgtgcggcgcgtggtgttcacgtcgtcctacggcgccgtgcacatgaaccccagcagg
agccccgacgccgtcctcgacgagacctgctggagcgactacgaattctgccgccaaacc
gacaacctgtactgctgcgccaagatgatggcagagatgacggcgacggaggaggcggcg
aagagggggctggagctggcggtggtggtgccgtcgatgacgatgggtcccatgctgcag
cagacgctcaacttcagcagcaaccacgtcgcccgctacctcatgggcaccaagaagtcg
taccccaacgccgtcgccgcctacgtcgacgtccgcgacgtcgcccgcgcgcacgtcctc
gtctacgagcgccccgacgcacgcggccgctacctctgcatcggcaccgtgctccaccgc
gccgagctcctccggatgctcagggacctcttcccccagtaccctgccactgcaaagtgt
gaagatgacgggaagccgatggcgaagccgtacaagttctcgaaccagaggctcaaggat
ttggggttggaattcactccactgaggaagagtttgcatgaggcggtcttatgcatgcag
cagaagagtcacctgcctctgatttatcccgttccaaaacgtgcttacctataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331102
Entry
4331102           CDS       T01015                                 
Name
(RefSeq) cinnamoyl-CoA reductase 2 isoform X1
  KO
K09753  cinnamoyl-CoA reductase [EC:1.2.1.44]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00940  Phenylpropanoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00039  Monolignol biosynthesis, phenylalanine/tyrosine => monolignol
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    4331102
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.44  cinnamoyl-CoA reductase
     4331102
SSDB
Motif
Pfam: Epimerase 3Beta_HSD NAD_binding_10 NmrA GDP_Man_Dehyd NAD_binding_4 Polysacc_synt_2 adh_short KR
Other DBs
NCBI-GeneID: 4331102
NCBI-ProteinID: XP_015623422
LinkDB
Position
2:34764335..34766566
AA seq 346 aa
MSCNSAEVAANDGSSNGGEKQQQQEEEVVCVTGAGGFIGSWVVKEHLLRGYRVRGTARDP
TKNAHLLALDGAGERLTLCRADVLDSESLRAAFAGCHGVFHVASPVSNDPNLVPIAVEGT
RNVVNAAADMGVRRVVFTSSYGAVHMNPNRSPDTVLDETCWSDPKFCRQTDVYCYAKTMA
EKAAEEEAAKRGVQLAVVLPCVTVGPILHPAINTSINHVVRYLTGAAPTYPNAVAAYVDV
RDVARAHALVYERHDARGRYLCIGAVLHRAHLLQMLKELFPQYPVTSKCKDDGNPMVEPY
KFSNQRLRDLGLEFTPLRKSLHEAIECLQRKGHLPVVTVAQQRACL
NT seq 1041 nt   +upstreamnt  +downstreamnt
atgtcgtgcaattctgccgaggtcgcggccaacgacggcagcagcaatggcggtgagaag
cagcagcagcaggaggaggaggtggtgtgcgtgacgggagcgggaggcttcatcggatca
tgggtggtgaaggagcacctcctccgtggctaccgcgtcaggggaacagccagggatccc
accaagaacgcccacctgctcgcgctcgacggagccggcgagaggctcaccctgtgccgc
gccgacgtcctggactccgagagcctgcgcgccgcgttcgccggatgccatggcgtcttc
cacgtcgcctccccggtgtccaatgaccctaatctggtgccgatcgcggtggaggggacg
aggaacgtggtgaacgcggcggcggacatgggcgtgcggcgcgtggtgttcacgtcgtcg
tacggcgccgtgcacatgaaccccaaccggagccccgacaccgtcctcgacgagacctgc
tggagcgaccccaaattctgccgccaaaccgacgtatactgctacgcgaagacgatggcg
gagaaggcggcggaggaggaggcggcaaagcgaggcgtgcagctggcggtggtgctgccc
tgcgtgacggtcgggccaatcttgcacccggccatcaacaccagcatcaaccacgtcgtc
cgctacctcacgggcgccgcgcccacctacccgaacgccgtcgcggcctacgtcgacgtc
cgcgacgtcgcccgcgcgcacgcactcgtctacgagcgccacgacgcccgcggccgctac
ctctgcatcggcgccgtgctccaccgcgcccatctcctccagatgctcaaggaacttttc
ccacagtaccccgtcacttccaagtgcaaggacgatgggaatccgatggtggaaccgtac
aagttctcgaaccagaggctcagggatttgggtttggagtttactccactgaggaagagc
ttgcatgaggcgatcgaatgtctgcagcgcaagggtcacctgcctgttgtcacggtggca
caacagcgtgcatgtttgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331103
Entry
4331103           CDS       T01015                                 
Name
(RefSeq) cinnamoyl-CoA reductase 2
  KO
K09753  cinnamoyl-CoA reductase [EC:1.2.1.44]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00940  Phenylpropanoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00039  Monolignol biosynthesis, phenylalanine/tyrosine => monolignol
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    4331103
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.44  cinnamoyl-CoA reductase
     4331103
SSDB
Motif
Pfam: Epimerase 3Beta_HSD NAD_binding_10 GDP_Man_Dehyd NAD_binding_4 NmrA Polysacc_synt_2 KR adh_short AP_endonuc_2
Other DBs
NCBI-GeneID: 4331103
NCBI-ProteinID: XP_015624675
UniProt: Q0DWJ7 A0A0P0VR58
LinkDB
Position
2:34769519..34771291
AA seq 334 aa
MSSISNDNNGDQKRQQQQQLVCVTGAGGFIGSWVVRELLLRGYRVRATVRDPADRKNAHL
LALEGAHERLSLRRADVLDFAGLLAAFAGCHGVFHVACPLSNRDPELMAVAVDGTRNVMN
AAADMGVRRVVFTSSYGAVHMNPNRSPDAVLDESCWSDPEFCRQKDMYCYAKTMAEMAAT
EEAAKRGLELAVVVPSMTMGPMLQRALNLSSTHVANYLTGAKKSYPNAVAAYVDVRDVAR
AHALVYERHDARGRYLCIGAVLHRAQLLQMLMDLFPQYTIASKCDDKGKPMVKPYEFSNQ
RLKDLGLEFTPLRKSLYDAVMCMQRNGHLPVVLP
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgtcgtccatttccaacgacaacaatggtgatcagaagcgacagcagcagcagcagctg
gtgtgcgtgaccggagcaggtggcttcatcgggtcatgggtggtgcgggagctcctcctc
cgtggctaccgcgtcagggccaccgtcagggaccccgcggaccgcaagaacgcccacctg
ctcgcgctggagggagcccacgagaggctctccctgcgccgcgccgatgtcctcgacttc
gccggcctcctcgccgcgttcgccgggtgccatggcgtcttccacgtcgcctgcccgctg
tccaaccgcgatccagagctgatggcggtcgcggtggatgggacgaggaacgtgatgaac
gcggcggcggacatgggcgtgcggcgcgtggtgttcacgtcgtcctacggcgccgtgcac
atgaaccccaaccggagccccgacgccgtcctcgacgagtcctgctggagcgaccccgaa
ttctgccggcaaaaagacatgtactgctacgcaaagacgatggcggagatggcggcgacg
gaggaggcggcgaagagggggctggagctggcggtggtggtgccgtcgatgacgatgggc
cccatgctgcagcgtgcgctcaacctcagcagcacgcacgtcgccaactacctcaccggc
gccaagaagtcgtacccgaacgccgtcgcggcctacgtcgacgtccgcgacgtcgcccgc
gcgcacgccctcgtctacgagcgccacgacgcgcgcggccgctacctctgcatcggcgcc
gtgctgcaccgcgcccagctcctccagatgctcatggacctcttcccccagtacaccatc
gcttcaaagtgtgatgacaaggggaagccgatggtgaagccgtatgagttttcgaaccag
aggctcaaggatttgggcttggaattcaccccgttgaggaagagtttgtacgacgcagtc
atgtgcatgcaacgaaacggtcacctgcctgtcgtcttgccatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345156
Entry
4345156           CDS       T01015                                 
Name
(RefSeq) cinnamoyl-CoA reductase 1
  KO
K09753  cinnamoyl-CoA reductase [EC:1.2.1.44]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00940  Phenylpropanoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00039  Monolignol biosynthesis, phenylalanine/tyrosine => monolignol
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    4345156
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.44  cinnamoyl-CoA reductase
     4345156
SSDB
Motif
Pfam: Epimerase NAD_binding_10 3Beta_HSD GDP_Man_Dehyd NmrA NAD_binding_4 Polysacc_synt_2 KR adh_short
Other DBs
NCBI-GeneID: 4345156
NCBI-ProteinID: XP_015648935
UniProt: Q6Z1M5 Q0J6R6
LinkDB
Position
8:10718581..10720794
AA seq 342 aa
MGVEKTTANGGSGAAAVSGGGRTVCVTGAGGFIASWLVKLLLEKGYAVRGTVRNPDDAAK
NAHLMALAGAAERLTLVRAELLDKESLAAAFAGCEGVFHTASPITDDPEKMIEPAVSGAR
NVITAAADAGGVRRVVMTSSIGAVYMGGGGGEEVDETCWSDLDHCRDTGNWYCYAKTVAE
QAAWELAKERRLDLVVVNPSLVLGPLLQRGVNASTWHVLKYLDGSARTYADAAQAYVHVR
DVADAHARAYESPAARGRYLCAGRTLHRGEVCRILAALFPGYPVPTRCKGDAGETAEGCR
FSSRKLAELGVAVMPASQCLYDTVVSLQDKGLLPFVPAAAMP
NT seq 1029 nt   +upstreamnt  +downstreamnt
atgggtgtcgagaagacgacggcgaacggcggcagtggcgccgcggcggtctccggcgga
gggcgcaccgtctgcgtcaccggcgccggcgggttcatcgcgtcgtggctcgtcaagctc
ctcctcgagaagggctacgccgtccgcggcaccgttcggaaccctgatgacgctgccaag
aacgcgcatctcatggcgctggccggtgccgcggagcggctgaccctcgtccgggcggag
ctgctcgacaaggagagcctcgccgccgcgttcgccggctgcgagggcgtcttccacacc
gcctcccccatcaccgacgacccggagaagatgatcgagccggcggtgagcggggcgagg
aacgtgatcaccgcggcggcggacgcgggcggcgtccgccgcgtggtgatgacgtcgtcg
atcggcgccgtgtacatgggcggcggcggcggcgaggaggtggacgagacgtgctggagc
gacctcgaccactgcagggacaccggaaactggtactgctacgccaagacggtggcggag
caggcggcgtgggagctcgccaaggagcggcggctggacctcgtcgtcgtcaacccgtcg
ctggtgctcggcccgctgctgcagcgcggggtgaacgccagcacgtggcacgtgctcaag
tacctggacggctcggcgcgcacctacgccgacgcggcgcaggcgtacgtgcacgtccgc
gacgtcgcggacgcgcacgcgcgcgcctacgagtcccccgccgcgcgcggccgctacctc
tgcgccggccgcacgctgcaccgcggcgaggtgtgccgcatcctggccgccctcttcccg
gggtacccggtgcccaccaggtgcaagggcgacgccggcgagacggccgaggggtgccgg
ttcagcagccgcaagctggcggagctcggtgtcgccgtcatgccggcgagccagtgcctg
tacgacaccgtcgtcagcctccaggacaagggcctgcttcccttcgtccctgccgccgcc
atgccgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345689
Entry
4345689           CDS       T01015                                 
Name
(RefSeq) cinnamoyl-CoA reductase 1
  KO
K09753  cinnamoyl-CoA reductase [EC:1.2.1.44]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00940  Phenylpropanoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00039  Monolignol biosynthesis, phenylalanine/tyrosine => monolignol
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    4345689
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.44  cinnamoyl-CoA reductase
     4345689
SSDB
Motif
Pfam: Epimerase 3Beta_HSD NAD_binding_10 NmrA GDP_Man_Dehyd NAD_binding_4 KR adh_short Polysacc_synt_2
Other DBs
NCBI-GeneID: 4345689
NCBI-ProteinID: XP_015650109
UniProt: Q6Z9E7 Q0J5E2
LinkDB
Position
8:complement(21506462..21513672)
AA seq 361 aa
MTVIDGAVAADAGGAAAAVVQPGNGQTVCVTGAAGYIASWLVKLLLEKGYTVKGTVRNPD
DPKNAHLKALDGAGERLVLCKADLLDYDAICRAVAGCHGVFHTASPVTDDPEQMVEPAVR
GTEYVINAAAEAGTVRRVVFTSSIGAVTMDPNRGPDVVVDESCWSDLDYCKETRNWYCYG
KAVAEQAAWEAARRRGVELVVVNPVLVIGPLLQPTVNASVAHILKYLDGSASKFANAVQA
YVDVRDVAAAHLLVFESPSAAGRFLCAESVLHREGVVRILAKLFPEYPVPTRCSDEKNPR
KQPYKMSNQKLRDLGLEFRPASQSLYETVKCLQEKGHLPVLAAEKTEEEAGEVQGGIAIR
A
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgaccgtgatcgacggcgccgtcgctgccgacgccggcggcgcagccgcggcggtggtg
cagccggggaacgggcagaccgtgtgcgtgaccggcgcggccgggtacatcgcgtcgtgg
ctcgtgaagctgctgcttgagaagggctacactgtcaagggcaccgtcaggaacccagat
gacccgaagaacgcgcacctgaaggcgctcgacggcgccggcgagcggctggtgctctgc
aaggccgacctcctcgactacgacgccatctgccgcgccgtcgccggctgccacggcgtc
ttccacaccgcctcccccgtcaccgacgaccccgagcagatggtggagccggcggtgagg
gggacggagtacgtgataaacgcggcggcggaggccggcacggtgcggcgggtggtgttc
acgtcgtcgatcggggcggtgaccatggaccccaaccgcgggcccgacgtcgtcgtcgac
gagtcctgctggagcgaccttgactactgcaaggaaaccaggaactggtactgctacggg
aaggcggtggcggagcaggcggcgtgggaggcggcgcggcggcgaggggtggagctggtg
gtggtgaacccggtgctggtgatcgggccgctgctgcagccgacggtgaacgccagcgtc
gcccacatcctcaagtacctggacggctcggccagcaagttcgccaacgccgtccaggcc
tacgtcgacgtccgcgacgtcgccgccgcccacctcctcgtcttcgagtccccttccgcc
gccggccgcttcctctgcgccgagtctgtcctccaccgcgagggtgtcgtccgcatcctc
gccaagctcttccccgagtaccctgtccccaccaggtgctccgacgagaagaaccccagg
aagcagccgtacaagatgtcgaaccagaagctccgggacctggggctggagttccggccg
gcgagccagtcgctgtacgagacggtgaagtgcctccaggagaagggccacctgccggtg
ctcgccgccgagaagacggaggaggaggccggcgaggtccagggcgggattgccatccga
gcatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346438
Entry
4346438           CDS       T01015                                 
Name
(RefSeq) cinnamoyl-CoA reductase 2
  KO
K09753  cinnamoyl-CoA reductase [EC:1.2.1.44]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00940  Phenylpropanoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00039  Monolignol biosynthesis, phenylalanine/tyrosine => monolignol
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    4346438
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.44  cinnamoyl-CoA reductase
     4346438
SSDB
Motif
Pfam: Epimerase 3Beta_HSD NAD_binding_10 GDP_Man_Dehyd NmrA NAD_binding_4 KR Polysacc_synt_2 adh_short
Other DBs
NCBI-GeneID: 4346438
NCBI-ProteinID: XP_015612613
UniProt: Q0J3E1 Q6K3G8
LinkDB
Position
9:complement(2083417..2086585)
AA seq 347 aa
MPTDETAAAAPATTALSGHGCTVCVTGAGGFIASWLVKRLLEKGYTVRGTVRNPMDPKND
HLRALDGAGERLVLLRADLLDPDSLVAAFTGCEGVFHAASPVTDDPEKMIEPAIRGTRYV
ITAAADTGIKRVVFTSSIGTVYMNPYRDPNKPVDDTCWSDLEYCKRTENWYCYAKTVAEQ
GAWEVARRRGVDLVVVNPVLVLGPLLQATVNASTEHVMKYLTGSAKTYVNAAQAYVHVRD
VAEAHVRVYDCGGARGRYICAESTLHRGDLCRALAKLFPEYPVPSRCKDEAAPPVKGYLF
SNQRLRDLGMDFVPVRQCLYETVRSLQDKGLLPVLPPTADDHHHPSS
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgccgactgacgagacagccgcggcggcgccggccaccaccgcgctctccggccatggg
tgcaccgtgtgcgtcaccggcgccggcgggttcatcgcgtcgtggctcgtcaagcgcctc
ctcgagaagggctacaccgtgcgtggcaccgtccggaaccctatggacccgaagaacgac
cacctgagagccctggacggcgccggcgagcgcctcgtcctcctccgcgccgacctcctc
gaccccgacagcctcgtcgccgccttcaccggctgcgagggcgtcttccacgctgcctcc
cccgtcaccgatgatcctgagaagatgatagagccggcgatcagggggacgagatacgtg
ataacggcggcggccgacaccggcatcaagcgagtggtgttcacgtcctccatcggcact
gtctacatgaacccctacagggaccccaacaagcccgtcgacgacacctgctggagtgac
ctcgaatactgcaagaggacagagaactggtactgctacgcgaagacggtggcggagcag
ggtgcgtgggaggtggcgcggcggcgtggggtggacctggtcgtagtgaacccggtgctg
gtgctgggaccgctgctgcaggcgacggtgaacgcgagcacggagcacgtgatgaagtac
ctgacggggtcggccaagacgtacgtgaacgcagcgcaggcgtacgtccacgtccgcgac
gtcgccgaggcgcacgtccgcgtgtacgactgcggcggcgcgcggggccggtacatctgc
gccgagagcaccctgcaccgcggcgacctctgccgcgccctcgccaagcttttcccggag
taccccgtcccgagcaggtgcaaggacgaggcggcgccgccggtgaaggggtacctcttc
tccaaccagcgcctccgtgacctcggcatggacttcgtccccgtccgccagtgcctctac
gaaaccgtgcgaagcctccaggacaagggcttgctgccggtgctgccgcccaccgccgac
gaccaccaccacccttcctcgtga

DBGET integrated database retrieval system